Pteropus vampyrus (Indian flying fox): 120616567 Help Entry 120616567         CDS       T07511                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04015   Rap1 signaling pathway pgig04810   Regulation of actin cytoskeleton pgig05014   Amyotrophic lateral sclerosis pgig05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     120616567 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     120616567 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120616567 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     120616567 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pgig04131]     120616567 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pgig04812]     120616567 (PFN3)    04147 Exosome [BR:pgig04147]     120616567 (PFN3) Membrane trafficking [BR:pgig04131]  Others   Actin-binding proteins    Others     120616567 (PFN3) Cytoskeleton proteins [BR:pgig04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      120616567 (PFN3) Exosome [BR:pgig04147]  Exosomal proteins   Proteins found in most exosomes    120616567 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  120616567 NCBI-ProteinID:  XP_039736016 UniProt:  A0A6P3Q7U3 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MSEWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGMDRCTFL QAGLSVAGRRCCVIRDHLLAEGDGVLDARTKGLDGRAVCVGHTPRALLVLMGRRGVHGGI LNKTVHELIRGLRTQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgagtgagtggaaaggctacatcagtgctgtgctgcgggatcagcgtatcgacgacgtg gcgattgtgggccactcggacaatcgctgcgtgtgggcgtcgcggcccgggggcctgctg gcggccatctcaccgcaggaggtgggtgtgctcacgggaatggaccgatgcaccttcctg caggcgggcctaagcgtagcaggccgccgctgctgcgtcatccgagaccacctgctggct gaaggcgacggagtgctggatgcgcgcaccaaggggttggatgggcgcgccgtctgcgtg ggccacacgccgcgcgcactcctcgtgctcatgggccgacggggcgtgcacgggggcatc ctcaacaagacggtgcacgagctgatccgcgggctgcgcactcagggcacctag

DBGET integrated database retrieval system