Pteropus vampyrus (Indian flying fox): 120616659 Help Entry 120616659         CDS       T07511                                  Name (RefSeq) interleukin-3-like   KO K04736   interleukin 3 Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04060   Cytokine-cytokine receptor interaction pgig04151   PI3K-Akt signaling pathway pgig04210   Apoptosis pgig04630   JAK-STAT signaling pathway pgig04640   Hematopoietic cell lineage pgig04664   Fc epsilon RI signaling pathway pgig05200   Pathways in cancer pgig05202   Transcriptional misregulation in cancer pgig05221   Acute myeloid leukemia pgig05310   Asthma Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     120616659    04151 PI3K-Akt signaling pathway     120616659   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120616659  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     120616659  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     120616659    04664 Fc epsilon RI signaling pathway     120616659  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120616659    05202 Transcriptional misregulation in cancer     120616659   09162 Cancer: specific types    05221 Acute myeloid leukemia     120616659   09163 Immune disease    05310 Asthma     120616659  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pgig04052]     120616659    00536 Glycosaminoglycan binding proteins [BR:pgig00536]     120616659 Cytokines and neuropeptides [BR:pgig04052]  Cytokines   Interleukins    120616659 Glycosaminoglycan binding proteins [BR:pgig00536]  Heparan sulfate / Heparin   Cytokines    120616659 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL3 Motif Other DBs NCBI-GeneID:  120616659 NCBI-ProteinID:  XP_039736257 LinkDB All DBs Position Unknown AA seq 142 aa AA seqDB search MSSLPILHLLLLLLTAHAPQAQGLPLPTSSTKEYVNMMMREIESILNKLPLPPQEPLDVN EIHILNNEAFLMLNLDTFLEATKNLQDKGMRIGKILEKLKETISSAPMTTEEPIYIKKGN WDDFWRKMTKYLNFLQNYLKKS NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atgagcagcctccccatcctgcaccttctcctgctcctgctcacagcccatgcccctcaa gcacaggggctgcccttgccgacgagctcgaccaaggaatacgtcaacatgatgatgagg gaaattgagagcatcctgaacaaactgcctttgcctccacaagaacccttggacgtaaat gagatacacatcctgaacaatgaggcctttctgatgctaaacctggataccttcctggaa gctaccaagaatttgcaggataaaggaatgagaattgggaaaattcttgagaaactcaaa gagacaatctcgtccgcccccatgaccacggaagagccaatctatatcaagaaaggtaac tgggacgatttctggaggaaaatgactaaatatctgaacttccttcagaactacctcaag aagtcctag

DBGET integrated database retrieval system