Pteropus vampyrus (Indian flying fox): 120617306 Help Entry 120617306         CDS       T07511                                  Name (RefSeq) metallothionein-2A   KO K14739   metallothionein 1/2 Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04978   Mineral absorption Brite KEGG Orthology (KO) [BR:pgig00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     120617306  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pgig03019]     120617306    03029 Mitochondrial biogenesis [BR:pgig03029]     120617306 Messenger RNA biogenesis [BR:pgig03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      120617306 Mitochondrial biogenesis [BR:pgig03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     120617306 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  120617306 NCBI-ProteinID:  XP_039736858 LinkDB All DBs Position Unknown AA seq 61 aa AA seqDB search MDPNCSCGTGGSCTCAGSCKCKDCRCTSCKKSCCSCCPVGCVKCAQGCICKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggatcccaactgctcctgcggcaccggtggctcctgcacctgcgccggctcctgcaaa tgcaaagactgcagatgcacctcctgcaagaagagctgctgctcctgctgccccgtgggc tgtgtcaagtgcgctcagggctgcatctgcaaaggagcatcggacaagtgcagctgctgt gcgtga

DBGET integrated database retrieval system