KEGG   Pteropus vampyrus (Indian flying fox): 120620121
Entry
120620121         CDS       T07511                                 
Symbol
MAPK3
Name
(RefSeq) LOW QUALITY PROTEIN: mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pgig  Pteropus vampyrus (Indian flying fox)
Pathway
pgig01521  EGFR tyrosine kinase inhibitor resistance
pgig01522  Endocrine resistance
pgig01524  Platinum drug resistance
pgig04010  MAPK signaling pathway
pgig04012  ErbB signaling pathway
pgig04014  Ras signaling pathway
pgig04015  Rap1 signaling pathway
pgig04022  cGMP-PKG signaling pathway
pgig04024  cAMP signaling pathway
pgig04062  Chemokine signaling pathway
pgig04066  HIF-1 signaling pathway
pgig04068  FoxO signaling pathway
pgig04071  Sphingolipid signaling pathway
pgig04072  Phospholipase D signaling pathway
pgig04114  Oocyte meiosis
pgig04140  Autophagy - animal
pgig04148  Efferocytosis
pgig04150  mTOR signaling pathway
pgig04151  PI3K-Akt signaling pathway
pgig04210  Apoptosis
pgig04218  Cellular senescence
pgig04261  Adrenergic signaling in cardiomyocytes
pgig04270  Vascular smooth muscle contraction
pgig04350  TGF-beta signaling pathway
pgig04360  Axon guidance
pgig04370  VEGF signaling pathway
pgig04371  Apelin signaling pathway
pgig04380  Osteoclast differentiation
pgig04510  Focal adhesion
pgig04517  IgSF CAM signaling
pgig04520  Adherens junction
pgig04540  Gap junction
pgig04550  Signaling pathways regulating pluripotency of stem cells
pgig04611  Platelet activation
pgig04613  Neutrophil extracellular trap formation
pgig04620  Toll-like receptor signaling pathway
pgig04621  NOD-like receptor signaling pathway
pgig04625  C-type lectin receptor signaling pathway
pgig04650  Natural killer cell mediated cytotoxicity
pgig04657  IL-17 signaling pathway
pgig04658  Th1 and Th2 cell differentiation
pgig04659  Th17 cell differentiation
pgig04660  T cell receptor signaling pathway
pgig04662  B cell receptor signaling pathway
pgig04664  Fc epsilon RI signaling pathway
pgig04666  Fc gamma R-mediated phagocytosis
pgig04668  TNF signaling pathway
pgig04713  Circadian entrainment
pgig04720  Long-term potentiation
pgig04722  Neurotrophin signaling pathway
pgig04723  Retrograde endocannabinoid signaling
pgig04724  Glutamatergic synapse
pgig04725  Cholinergic synapse
pgig04726  Serotonergic synapse
pgig04730  Long-term depression
pgig04810  Regulation of actin cytoskeleton
pgig04910  Insulin signaling pathway
pgig04912  GnRH signaling pathway
pgig04914  Progesterone-mediated oocyte maturation
pgig04915  Estrogen signaling pathway
pgig04916  Melanogenesis
pgig04917  Prolactin signaling pathway
pgig04919  Thyroid hormone signaling pathway
pgig04921  Oxytocin signaling pathway
pgig04926  Relaxin signaling pathway
pgig04928  Parathyroid hormone synthesis, secretion and action
pgig04929  GnRH secretion
pgig04930  Type II diabetes mellitus
pgig04933  AGE-RAGE signaling pathway in diabetic complications
pgig04934  Cushing syndrome
pgig04935  Growth hormone synthesis, secretion and action
pgig04960  Aldosterone-regulated sodium reabsorption
pgig05010  Alzheimer disease
pgig05020  Prion disease
pgig05022  Pathways of neurodegeneration - multiple diseases
pgig05034  Alcoholism
pgig05132  Salmonella infection
pgig05133  Pertussis
pgig05135  Yersinia infection
pgig05140  Leishmaniasis
pgig05142  Chagas disease
pgig05145  Toxoplasmosis
pgig05152  Tuberculosis
pgig05160  Hepatitis C
pgig05161  Hepatitis B
pgig05163  Human cytomegalovirus infection
pgig05164  Influenza A
pgig05165  Human papillomavirus infection
pgig05166  Human T-cell leukemia virus 1 infection
pgig05167  Kaposi sarcoma-associated herpesvirus infection
pgig05170  Human immunodeficiency virus 1 infection
pgig05171  Coronavirus disease - COVID-19
pgig05200  Pathways in cancer
pgig05203  Viral carcinogenesis
pgig05205  Proteoglycans in cancer
pgig05206  MicroRNAs in cancer
pgig05207  Chemical carcinogenesis - receptor activation
pgig05208  Chemical carcinogenesis - reactive oxygen species
pgig05210  Colorectal cancer
pgig05211  Renal cell carcinoma
pgig05212  Pancreatic cancer
pgig05213  Endometrial cancer
pgig05214  Glioma
pgig05215  Prostate cancer
pgig05216  Thyroid cancer
pgig05218  Melanoma
pgig05219  Bladder cancer
pgig05220  Chronic myeloid leukemia
pgig05221  Acute myeloid leukemia
pgig05223  Non-small cell lung cancer
pgig05224  Breast cancer
pgig05225  Hepatocellular carcinoma
pgig05226  Gastric cancer
pgig05230  Central carbon metabolism in cancer
pgig05231  Choline metabolism in cancer
pgig05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pgig05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pgig00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    120620121 (MAPK3)
   04012 ErbB signaling pathway
    120620121 (MAPK3)
   04014 Ras signaling pathway
    120620121 (MAPK3)
   04015 Rap1 signaling pathway
    120620121 (MAPK3)
   04350 TGF-beta signaling pathway
    120620121 (MAPK3)
   04370 VEGF signaling pathway
    120620121 (MAPK3)
   04371 Apelin signaling pathway
    120620121 (MAPK3)
   04668 TNF signaling pathway
    120620121 (MAPK3)
   04066 HIF-1 signaling pathway
    120620121 (MAPK3)
   04068 FoxO signaling pathway
    120620121 (MAPK3)
   04072 Phospholipase D signaling pathway
    120620121 (MAPK3)
   04071 Sphingolipid signaling pathway
    120620121 (MAPK3)
   04024 cAMP signaling pathway
    120620121 (MAPK3)
   04022 cGMP-PKG signaling pathway
    120620121 (MAPK3)
   04151 PI3K-Akt signaling pathway
    120620121 (MAPK3)
   04150 mTOR signaling pathway
    120620121 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    120620121 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    120620121 (MAPK3)
   04148 Efferocytosis
    120620121 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    120620121 (MAPK3)
   04210 Apoptosis
    120620121 (MAPK3)
   04218 Cellular senescence
    120620121 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    120620121 (MAPK3)
   04520 Adherens junction
    120620121 (MAPK3)
   04540 Gap junction
    120620121 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    120620121 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    120620121 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    120620121 (MAPK3)
   04613 Neutrophil extracellular trap formation
    120620121 (MAPK3)
   04620 Toll-like receptor signaling pathway
    120620121 (MAPK3)
   04621 NOD-like receptor signaling pathway
    120620121 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    120620121 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    120620121 (MAPK3)
   04660 T cell receptor signaling pathway
    120620121 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    120620121 (MAPK3)
   04659 Th17 cell differentiation
    120620121 (MAPK3)
   04657 IL-17 signaling pathway
    120620121 (MAPK3)
   04662 B cell receptor signaling pathway
    120620121 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    120620121 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    120620121 (MAPK3)
   04062 Chemokine signaling pathway
    120620121 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    120620121 (MAPK3)
   04929 GnRH secretion
    120620121 (MAPK3)
   04912 GnRH signaling pathway
    120620121 (MAPK3)
   04915 Estrogen signaling pathway
    120620121 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    120620121 (MAPK3)
   04917 Prolactin signaling pathway
    120620121 (MAPK3)
   04921 Oxytocin signaling pathway
    120620121 (MAPK3)
   04926 Relaxin signaling pathway
    120620121 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    120620121 (MAPK3)
   04919 Thyroid hormone signaling pathway
    120620121 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    120620121 (MAPK3)
   04916 Melanogenesis
    120620121 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    120620121 (MAPK3)
   04270 Vascular smooth muscle contraction
    120620121 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    120620121 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    120620121 (MAPK3)
   04725 Cholinergic synapse
    120620121 (MAPK3)
   04726 Serotonergic synapse
    120620121 (MAPK3)
   04720 Long-term potentiation
    120620121 (MAPK3)
   04730 Long-term depression
    120620121 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    120620121 (MAPK3)
   04722 Neurotrophin signaling pathway
    120620121 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    120620121 (MAPK3)
   04380 Osteoclast differentiation
    120620121 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    120620121 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    120620121 (MAPK3)
   05206 MicroRNAs in cancer
    120620121 (MAPK3)
   05205 Proteoglycans in cancer
    120620121 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    120620121 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    120620121 (MAPK3)
   05203 Viral carcinogenesis
    120620121 (MAPK3)
   05230 Central carbon metabolism in cancer
    120620121 (MAPK3)
   05231 Choline metabolism in cancer
    120620121 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    120620121 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    120620121 (MAPK3)
   05212 Pancreatic cancer
    120620121 (MAPK3)
   05225 Hepatocellular carcinoma
    120620121 (MAPK3)
   05226 Gastric cancer
    120620121 (MAPK3)
   05214 Glioma
    120620121 (MAPK3)
   05216 Thyroid cancer
    120620121 (MAPK3)
   05221 Acute myeloid leukemia
    120620121 (MAPK3)
   05220 Chronic myeloid leukemia
    120620121 (MAPK3)
   05218 Melanoma
    120620121 (MAPK3)
   05211 Renal cell carcinoma
    120620121 (MAPK3)
   05219 Bladder cancer
    120620121 (MAPK3)
   05215 Prostate cancer
    120620121 (MAPK3)
   05213 Endometrial cancer
    120620121 (MAPK3)
   05224 Breast cancer
    120620121 (MAPK3)
   05223 Non-small cell lung cancer
    120620121 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    120620121 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    120620121 (MAPK3)
   05161 Hepatitis B
    120620121 (MAPK3)
   05160 Hepatitis C
    120620121 (MAPK3)
   05171 Coronavirus disease - COVID-19
    120620121 (MAPK3)
   05164 Influenza A
    120620121 (MAPK3)
   05163 Human cytomegalovirus infection
    120620121 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    120620121 (MAPK3)
   05165 Human papillomavirus infection
    120620121 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    120620121 (MAPK3)
   05135 Yersinia infection
    120620121 (MAPK3)
   05133 Pertussis
    120620121 (MAPK3)
   05152 Tuberculosis
    120620121 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    120620121 (MAPK3)
   05140 Leishmaniasis
    120620121 (MAPK3)
   05142 Chagas disease
    120620121 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    120620121 (MAPK3)
   05020 Prion disease
    120620121 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    120620121 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    120620121 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    120620121 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    120620121 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    120620121 (MAPK3)
   04934 Cushing syndrome
    120620121 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    120620121 (MAPK3)
   01524 Platinum drug resistance
    120620121 (MAPK3)
   01522 Endocrine resistance
    120620121 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pgig01001]
    120620121 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pgig03036]
    120620121 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgig04147]
    120620121 (MAPK3)
Enzymes [BR:pgig01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     120620121 (MAPK3)
Protein kinases [BR:pgig01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   120620121 (MAPK3)
Chromosome and associated proteins [BR:pgig03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     120620121 (MAPK3)
Exosome [BR:pgig04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   120620121 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 120620121
NCBI-ProteinID: XP_039740522
LinkDB
Position
Unknown
AA seq 382 aa
MAAAAAAAAAQGGGGGEPRGADGVGPGVSGEVEIVKGQPFDVGPRYXNCTYSEGAYGMVS
SAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFHHENVIGIRDILRAPTLEAMRD
VYIVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTT
CDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAE
MLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFP
KSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPK
ERLKELIFQETARFQPGVLEAH
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcggcggctcaggggggcgggggcggggagccccgggga
gctgatggggtcggcccgggggtctctggggaagtggagatagtgaaggggcagccgttc
gacgtgggcccgcgctacngcaactgcacatacagcgagggcgcctatggcatggtcagc
tcagcttacgaccatgtgcgcaagacacgcgtagccatcaagaaaatcagccccttcgag
catcagacctactgccagcgcacactgcgggagatccagatcttgctgcgcttccaccat
gagaatgtcattggcatccgagatattctgcgtgcacccaccctggaagccatgagggat
gtctacattgtgcaggacctgatggagacagacctgtacaagttgctcaaaagccagcag
ctgagcaacgaccatgtctgctacttcctctaccagatcctgcggggcctcaagtatatt
cactcagccaacgtactccaccgggatttaaagccctccaacctgctcatcaacaccacc
tgcgaccttaagatctgcgattttggcctggcccggatcgccgatcctgagcatgaccac
actggattcctgacagaatacgtggccacacgctggtaccgggccccagagatcatgctt
aactccaagggctacaccaagtccatcgacatctggtctgtaggctgcattctggctgag
atgctctccaaccggcccatcttccctggcaagcactacctggaccagctcaaccatatt
ctgggtatcctgggctccccatctcaggaggacctgaattgtatcatcaacatgaaggcc
cgaaactacctacagtctctgccctccaagaccaaggtggcctgggccaagctttttccc
aagtcagactccaaagcccttgatctgctggaccggatgttgacctttaaccccaataaa
cggatcacagtggaagaagccttggctcacccctacttggagcagtactatgacccaaca
gatgagccggtggctgaggaacctttcaccttcgacatggagctcgatgatctacccaag
gagcggctgaaggagctcatattccaggagacagcccgcttccagcctggggtgctggag
gcccactaa

DBGET integrated database retrieval system