Pteropus vampyrus (Indian flying fox): 120620288 Help Entry 120620288         CDS       T07511                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04066   HIF-1 signaling pathway pgig04120   Ubiquitin mediated proteolysis pgig05170   Human immunodeficiency virus 1 infection pgig05200   Pathways in cancer pgig05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:pgig00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     120620288 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     120620288 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120620288 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     120620288 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     120620288 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pgig04121]     120620288 (ELOB)    03400 DNA repair and recombination proteins [BR:pgig03400]     120620288 (ELOB) Ubiquitin system [BR:pgig04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      120620288 (ELOB)    Cul5 complex      120620288 (ELOB) DNA repair and recombination proteins [BR:pgig03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      120620288 (ELOB) SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  120620288 NCBI-ProteinID:  XP_039741012 UniProt:  A0A6P3R5P0 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC GFTSQTARPQAPATVGLAFRADDAFEALRIEPFSSPPELPDVMKPQDSGSSANEQAVQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttccttatgatccgacgccacaagaccaccattttcacggacgccaaggag tcgagtaccgtgtttgagctgaagcgtatcgtcgagggcattcttaagcggcctcctgac gagcagcggctgtacaaggatgaccagcttctggatgatggcaagacactgggtgagtgt ggattcaccagtcagacagcgcgaccgcaggccccagccactgtggggctggccttccga gcagatgatgcatttgaggccctgcgcatcgagcccttttccagcccaccagagctgcct gacgtgatgaagccacaggactcaggaagcagcgccaacgaacaagccgtgcagtga

DBGET integrated database retrieval system