Pteropus vampyrus (Indian flying fox): 120620883 Help Entry 120620883         CDS       T07511                                  Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04060   Cytokine-cytokine receptor interaction pgig04061   Viral protein interaction with cytokine and cytokine receptor pgig04062   Chemokine signaling pathway pgig04620   Toll-like receptor signaling pathway pgig04621   NOD-like receptor signaling pathway pgig04623   Cytosolic DNA-sensing pathway pgig04668   TNF signaling pathway pgig05020   Prion disease pgig05142   Chagas disease pgig05163   Human cytomegalovirus infection pgig05164   Influenza A pgig05168   Herpes simplex virus 1 infection pgig05323   Rheumatoid arthritis pgig05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     120620883   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120620883    04061 Viral protein interaction with cytokine and cytokine receptor     120620883  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120620883    04621 NOD-like receptor signaling pathway     120620883    04623 Cytosolic DNA-sensing pathway     120620883    04062 Chemokine signaling pathway     120620883  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     120620883    05168 Herpes simplex virus 1 infection     120620883    05163 Human cytomegalovirus infection     120620883   09174 Infectious disease: parasitic    05142 Chagas disease     120620883   09163 Immune disease    05323 Rheumatoid arthritis     120620883   09164 Neurodegenerative disease    05020 Prion disease     120620883   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120620883  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pgig04052]     120620883    00536 Glycosaminoglycan binding proteins [BR:pgig00536]     120620883 Cytokines and neuropeptides [BR:pgig04052]  Cytokines   Chemokines    120620883 Glycosaminoglycan binding proteins [BR:pgig00536]  Heparan sulfate / Heparin   Chemokines    120620883 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  120620883 NCBI-ProteinID:  XP_039741870 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MKISAAALAVLLATAAFCAPSSASPYASDTTPCCFAYISRPLPRAHLQEYFYTSSKCSMP AVVFVTRKKRQVCADPEKRWVREYINSFEMS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaagatctctgcagctgccctcgctgtccttcttgccactgccgccttctgcgctcct tcatctgcctccccatatgcctcggacaccacaccttgctgctttgcctacatctctcgc ccactgccccgtgcccacctccaggagtatttctacaccagcagcaagtgctccatgcca gcagtcgtcttcgttacccgaaaaaaacgccaggtgtgtgccgacccagagaagagatgg gtacgggagtacatcaactctttcgagatgagctag

DBGET integrated database retrieval system