Pteropus vampyrus (Indian flying fox): 120621579 Help Entry 120621579         CDS       T07511                                  Symbol RAB1A Name (RefSeq) ras-related protein Rab-1A   KO K07874   Ras-related protein Rab-1A Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04140   Autophagy - animal pgig05014   Amyotrophic lateral sclerosis pgig05022   Pathways of neurodegeneration - multiple diseases pgig05134   Legionellosis Brite KEGG Orthology (KO) [BR:pgig00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120621579 (RAB1A)  09160 Human Diseases   09171 Infectious disease: bacterial    05134 Legionellosis     120621579 (RAB1A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     120621579 (RAB1A)    05022 Pathways of neurodegeneration - multiple diseases     120621579 (RAB1A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pgig04131]     120621579 (RAB1A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pgig04147]     120621579 (RAB1A)    04031 GTP-binding proteins [BR:pgig04031]     120621579 (RAB1A) Membrane trafficking [BR:pgig04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab GTPases     120621579 (RAB1A)  Autophagy   Other autophagy associated proteins     120621579 (RAB1A) Exosome [BR:pgig04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120621579 (RAB1A)   Exosomal proteins of other body fluids (saliva and urine)    120621579 (RAB1A)   Exosomal proteins of colorectal cancer cells    120621579 (RAB1A) GTP-binding proteins [BR:pgig04031]  Small (monomeric) G-proteins   Rab Family    Rab1/35 [OT]     120621579 (RAB1A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 Gtr1_RagA SRPRB FeoB_N AAA ABC_tran AAA_7 PduV-EutP AAA_29 LANC_like AAA_16 AAA_22 Septin AAA_5 Dioxygenase_N CRAL_TRIO_2 TniB Motif Other DBs NCBI-GeneID:  120621579 NCBI-ProteinID:  XP_039742918 UniProt:  A0A6P3RGZ0 LinkDB All DBs Position Unknown AA seq 205 aa AA seqDB search MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGA TAGGAEKSNVKIQSTPVKQSGGGCC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtccagcatgaatcccgaatatgattatttattcaagttacttctgattggagactct ggagttggaaagtcttgcctccttcttagatttgcagatgatacatatacagaaagctac atcagcacaattggtgtggatttcaaaataagaactatagagttagatgggaaaacaatc aagcttcaaatttgggacacagcgggccaagaaagatttcgaacaatcacctccagttat tacagaggagcgcatggcatcatagttgtgtatgatgtgacagatcaggagtccttcaat aacgttaaacagtggctgcaggaaatagatcgttatgccagtgaaaatgtcaacaagttg ttggtagggaacaaatgtgatctgaccacaaagaaagtagtagactacacaacagcaaag gaatttgctgattctcttggaattccatttttggaaaccagtgctaaaaacgcaacgaat gtagaacaatctttcatgacgatggcagctgagattaaaaagcgaatgggtcctggagca acagctggtggtgcagaaaagtccaatgttaaaattcagagcactccggtcaagcagtca ggtggaggttgctgctaa

DBGET integrated database retrieval system