Pteropus vampyrus (Indian flying fox): 120621675 Help Entry 120621675         CDS       T07511                                  Symbol CALM2 Name (RefSeq) calmodulin-2 isoform X1   KO K02183   calmodulin Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04014   Ras signaling pathway pgig04015   Rap1 signaling pathway pgig04020   Calcium signaling pathway pgig04022   cGMP-PKG signaling pathway pgig04024   cAMP signaling pathway pgig04070   Phosphatidylinositol signaling system pgig04114   Oocyte meiosis pgig04218   Cellular senescence pgig04261   Adrenergic signaling in cardiomyocytes pgig04270   Vascular smooth muscle contraction pgig04371   Apelin signaling pathway pgig04625   C-type lectin receptor signaling pathway pgig04713   Circadian entrainment pgig04720   Long-term potentiation pgig04722   Neurotrophin signaling pathway pgig04728   Dopaminergic synapse pgig04740   Olfactory transduction pgig04744   Phototransduction pgig04750   Inflammatory mediator regulation of TRP channels pgig04910   Insulin signaling pathway pgig04912   GnRH signaling pathway pgig04915   Estrogen signaling pathway pgig04916   Melanogenesis pgig04921   Oxytocin signaling pathway pgig04922   Glucagon signaling pathway pgig04924   Renin secretion pgig04925   Aldosterone synthesis and secretion pgig04970   Salivary secretion pgig04971   Gastric acid secretion pgig05010   Alzheimer disease pgig05012   Parkinson disease pgig05022   Pathways of neurodegeneration - multiple diseases pgig05031   Amphetamine addiction pgig05034   Alcoholism pgig05133   Pertussis pgig05152   Tuberculosis pgig05163   Human cytomegalovirus infection pgig05167   Kaposi sarcoma-associated herpesvirus infection pgig05170   Human immunodeficiency virus 1 infection pgig05200   Pathways in cancer pgig05214   Glioma pgig05417   Lipid and atherosclerosis pgig05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     120621675 (CALM2)    04015 Rap1 signaling pathway     120621675 (CALM2)    04371 Apelin signaling pathway     120621675 (CALM2)    04020 Calcium signaling pathway     120621675 (CALM2)    04070 Phosphatidylinositol signaling system     120621675 (CALM2)    04024 cAMP signaling pathway     120621675 (CALM2)    04022 cGMP-PKG signaling pathway     120621675 (CALM2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     120621675 (CALM2)    04218 Cellular senescence     120621675 (CALM2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120621675 (CALM2)   09152 Endocrine system    04910 Insulin signaling pathway     120621675 (CALM2)    04922 Glucagon signaling pathway     120621675 (CALM2)    04912 GnRH signaling pathway     120621675 (CALM2)    04915 Estrogen signaling pathway     120621675 (CALM2)    04921 Oxytocin signaling pathway     120621675 (CALM2)    04916 Melanogenesis     120621675 (CALM2)    04924 Renin secretion     120621675 (CALM2)    04925 Aldosterone synthesis and secretion     120621675 (CALM2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     120621675 (CALM2)    04270 Vascular smooth muscle contraction     120621675 (CALM2)   09154 Digestive system    04970 Salivary secretion     120621675 (CALM2)    04971 Gastric acid secretion     120621675 (CALM2)   09156 Nervous system    04728 Dopaminergic synapse     120621675 (CALM2)    04720 Long-term potentiation     120621675 (CALM2)    04722 Neurotrophin signaling pathway     120621675 (CALM2)   09157 Sensory system    04744 Phototransduction     120621675 (CALM2)    04740 Olfactory transduction     120621675 (CALM2)    04750 Inflammatory mediator regulation of TRP channels     120621675 (CALM2)   09159 Environmental adaptation    04713 Circadian entrainment     120621675 (CALM2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120621675 (CALM2)   09162 Cancer: specific types    05214 Glioma     120621675 (CALM2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     120621675 (CALM2)    05163 Human cytomegalovirus infection     120621675 (CALM2)    05167 Kaposi sarcoma-associated herpesvirus infection     120621675 (CALM2)   09171 Infectious disease: bacterial    05133 Pertussis     120621675 (CALM2)    05152 Tuberculosis     120621675 (CALM2)   09164 Neurodegenerative disease    05010 Alzheimer disease     120621675 (CALM2)    05012 Parkinson disease     120621675 (CALM2)    05022 Pathways of neurodegeneration - multiple diseases     120621675 (CALM2)   09165 Substance dependence    05031 Amphetamine addiction     120621675 (CALM2)    05034 Alcoholism     120621675 (CALM2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120621675 (CALM2)    05418 Fluid shear stress and atherosclerosis     120621675 (CALM2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pgig01009]     120621675 (CALM2)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pgig04131]     120621675 (CALM2)    03036 Chromosome and associated proteins [BR:pgig03036]     120621675 (CALM2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pgig04147]     120621675 (CALM2) Protein phosphatases and associated proteins [BR:pgig01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      120621675 (CALM2) Membrane trafficking [BR:pgig04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     120621675 (CALM2) Chromosome and associated proteins [BR:pgig03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      120621675 (CALM2) Exosome [BR:pgig04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    120621675 (CALM2) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 EH Allatotropin-like_C EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 SAPC2_N EFhand_Ca_insen Dockerin_1 EF-hand_EFHB_C FCaBP_EF-hand BamM_C Caleosin DUF5580_M TerB DUF1103 SPEF2_C EF-hand_STIM1 SurA_N_3 DUF2267 PA_Ig-like Motif Other DBs NCBI-GeneID:  120621675 NCBI-ProteinID:  XP_039743167 LinkDB All DBs Position Unknown AA seq 156 aa AA seqDB search MTGWTYHLADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMI NEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNL GEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgactggttggacttatcatttggctgaccaactgactgaagagcaaattgcagaattc aaagaagctttttcactatttgacaaggatggtgatggaactataacaacaaaggaattg ggaactgtaatgagatctcttgggcagaatcccacagaagcagagttacaggacatgatt aatgaagtggatgctgatggaaacggcacaattgacttcccagaatttctgacaatgatg gcaagaaaaatgaaagacacagacagtgaagaagaaattagagaagcattccgtgtgttt gacaaggatggcaatggatatattagtgcagcagagcttcgccatgtgatgacaaacctt ggagagaagttaacagatgaagaggttgatgagatgatcagggaagcagatattgatggt gatggtcaagtaaactatgaagagtttgtacaaatgatgacagcaaagtga

DBGET integrated database retrieval system