Pteropus vampyrus (Indian flying fox): 120621837 Help Entry 120621837         CDS       T07511                                  Symbol JUN Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig01522   Endocrine resistance pgig04010   MAPK signaling pathway pgig04012   ErbB signaling pathway pgig04024   cAMP signaling pathway pgig04137   Mitophagy - animal pgig04210   Apoptosis pgig04310   Wnt signaling pathway pgig04380   Osteoclast differentiation pgig04510   Focal adhesion pgig04530   Tight junction pgig04620   Toll-like receptor signaling pathway pgig04621   NOD-like receptor signaling pathway pgig04625   C-type lectin receptor signaling pathway pgig04657   IL-17 signaling pathway pgig04658   Th1 and Th2 cell differentiation pgig04659   Th17 cell differentiation pgig04660   T cell receptor signaling pathway pgig04662   B cell receptor signaling pathway pgig04668   TNF signaling pathway pgig04722   Neurotrophin signaling pathway pgig04912   GnRH signaling pathway pgig04915   Estrogen signaling pathway pgig04921   Oxytocin signaling pathway pgig04926   Relaxin signaling pathway pgig04932   Non-alcoholic fatty liver disease pgig04933   AGE-RAGE signaling pathway in diabetic complications pgig05030   Cocaine addiction pgig05031   Amphetamine addiction pgig05132   Salmonella infection pgig05133   Pertussis pgig05135   Yersinia infection pgig05140   Leishmaniasis pgig05142   Chagas disease pgig05161   Hepatitis B pgig05162   Measles pgig05166   Human T-cell leukemia virus 1 infection pgig05167   Kaposi sarcoma-associated herpesvirus infection pgig05169   Epstein-Barr virus infection pgig05170   Human immunodeficiency virus 1 infection pgig05171   Coronavirus disease - COVID-19 pgig05200   Pathways in cancer pgig05203   Viral carcinogenesis pgig05207   Chemical carcinogenesis - receptor activation pgig05208   Chemical carcinogenesis - reactive oxygen species pgig05210   Colorectal cancer pgig05211   Renal cell carcinoma pgig05224   Breast cancer pgig05231   Choline metabolism in cancer pgig05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pgig05321   Inflammatory bowel disease pgig05323   Rheumatoid arthritis pgig05417   Lipid and atherosclerosis pgig05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120621837 (JUN)    04012 ErbB signaling pathway     120621837 (JUN)    04310 Wnt signaling pathway     120621837 (JUN)    04668 TNF signaling pathway     120621837 (JUN)    04024 cAMP signaling pathway     120621837 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     120621837 (JUN)   09143 Cell growth and death    04210 Apoptosis     120621837 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     120621837 (JUN)    04530 Tight junction     120621837 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120621837 (JUN)    04621 NOD-like receptor signaling pathway     120621837 (JUN)    04625 C-type lectin receptor signaling pathway     120621837 (JUN)    04660 T cell receptor signaling pathway     120621837 (JUN)    04658 Th1 and Th2 cell differentiation     120621837 (JUN)    04659 Th17 cell differentiation     120621837 (JUN)    04657 IL-17 signaling pathway     120621837 (JUN)    04662 B cell receptor signaling pathway     120621837 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     120621837 (JUN)    04915 Estrogen signaling pathway     120621837 (JUN)    04921 Oxytocin signaling pathway     120621837 (JUN)    04926 Relaxin signaling pathway     120621837 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     120621837 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     120621837 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120621837 (JUN)    05207 Chemical carcinogenesis - receptor activation     120621837 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     120621837 (JUN)    05203 Viral carcinogenesis     120621837 (JUN)    05231 Choline metabolism in cancer     120621837 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     120621837 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     120621837 (JUN)    05211 Renal cell carcinoma     120621837 (JUN)    05224 Breast cancer     120621837 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     120621837 (JUN)    05170 Human immunodeficiency virus 1 infection     120621837 (JUN)    05161 Hepatitis B     120621837 (JUN)    05171 Coronavirus disease - COVID-19     120621837 (JUN)    05162 Measles     120621837 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     120621837 (JUN)    05169 Epstein-Barr virus infection     120621837 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     120621837 (JUN)    05135 Yersinia infection     120621837 (JUN)    05133 Pertussis     120621837 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     120621837 (JUN)    05142 Chagas disease     120621837 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     120621837 (JUN)    05321 Inflammatory bowel disease     120621837 (JUN)   09165 Substance dependence    05030 Cocaine addiction     120621837 (JUN)    05031 Amphetamine addiction     120621837 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120621837 (JUN)    05418 Fluid shear stress and atherosclerosis     120621837 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     120621837 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     120621837 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     120621837 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pgig03000]     120621837 (JUN) Transcription factors [BR:pgig03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     120621837 (JUN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha DUF3450 FlaC_arch TFIIA Motif Other DBs NCBI-GeneID:  120621837 NCBI-ProteinID:  XP_039743483 UniProt:  A0A6P3RK53 LinkDB All DBs Position Unknown AA seq 334 aa AA seqDB search MTAKMETTFYDDALNVSFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNADL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGSGSSGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgcccttaacgtctcgttcctccaa tccgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg aacctggccgacccggtgggtagcctgaagccacacctccgggccaagaacgcggacctc ctcacctcgcccgatgtgggactgctcaaactggcgtcgccagagctggagcgcctaata atccagtccagcaacgggcacatcaccaccacgccgacccctacccagttcctgtgcccc aagaacgtgacggacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa ctgcacagccagaacacgctacccagcgtcacgtccgcggcgcagccggtcagcggggct ggcatggtggctcccgcagtggcttccgtggcgggcggcagcggcagcagcggcttcagt gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccgggcgcg ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcag ccccagcaacagcaacagccaccgcagcctccgcaccacctgccccagcagatcccggtg cagcacccgcggctgcaagccctgaaggaggagccgcagacggtacccgagatgcccggg gaaacgccgcccctgtcgcctatcgacatggagtcccaagagcggatcaaggcggagagg aaacgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagaggatc gccaggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacg gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system