Panacibacter ginsenosidivorans: FRZ67_09925 Help Entry FRZ67_09925       CDS       T06131                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pgin  Panacibacter ginsenosidivorans Brite KEGG Orthology (KO) [BR:pgin00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pgin03032]     FRZ67_09925    03036 Chromosome and associated proteins [BR:pgin03036]     FRZ67_09925    03400 DNA repair and recombination proteins [BR:pgin03400]     FRZ67_09925 DNA replication proteins [BR:pgin03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     FRZ67_09925 Chromosome and associated proteins [BR:pgin03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     FRZ67_09925 DNA repair and recombination proteins [BR:pgin03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       FRZ67_09925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  QEC67591 UniProt:  A0A5B8V9Q7 LinkDB All DBs Position 2370331..2370600 Genome browser AA seq 89 aa AA seqDB search MNKAELVAKLADDAGITKTQANSALDSFVEAVTKTLKGGGKVTLVGFGTFSVSKRAARTG RNPQTGAAIKIKAKKVARFKAGKELSAKL NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaacaaagctgaattggttgccaaactcgcggatgatgctggcatcacaaaaacacag gctaactctgcacttgactctttcgttgaagctgttacaaaaactttgaaaggtggtggc aaggttacattggtaggttttggtactttctcagtatccaaacgtgctgcacgtactggc cgtaacccgcaaacaggcgctgctataaagatcaaagctaaaaaagtagcacgctttaaa gccggtaaagaactcagtgctaaattgtaa

DBGET integrated database retrieval system