Paraburkholderia ginsengisoli: I6I06_16235 Help Entry I6I06_16235       CDS       T07246                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pgis  Paraburkholderia ginsengisoli Pathway pgis00998   Biosynthesis of various antibiotics pgis01100   Metabolic pathways pgis01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pgis00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I6I06_16235    00074 Mycolic acid biosynthesis     I6I06_16235   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I6I06_16235 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TerB Motif Other DBs NCBI-ProteinID:  QQC63817 UniProt:  A0A7T4N241 LinkDB All DBs Position 1:3618992..3619243 Genome browser AA seq 83 aa AA seqDB search MSDAEILERIRAIFKENFAIEPERVTPDAHLFEDLDLDSIDAVDLAIKLQEMTGRRIKPE EFKSVRTVGDVIGAVESLLAAQG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgtccgacgcagagattcttgaacgcatccgcgcgatcttcaaagagaacttcgccatc gagcccgagcgcgtgacgcccgacgcgcatctgttcgaagacctcgatctcgacagcatc gacgctgtcgacctcgcgatcaaactgcaggaaatgaccggccgccgtatcaagccggaa gagttcaaatcggtgcgcaccgtcggcgacgtgatcggtgcggtcgaatccctgctggcg gcccaaggctga

DBGET integrated database retrieval system