Paraburkholderia ginsengisoli: I6I06_22000 Help Entry I6I06_22000       CDS       T07246                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pgis  Paraburkholderia ginsengisoli Pathway pgis00998   Biosynthesis of various antibiotics pgis01100   Metabolic pathways pgis01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pgis00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I6I06_22000    00074 Mycolic acid biosynthesis     I6I06_22000   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I6I06_22000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QQC67580 UniProt:  A0A7T4TCI7 LinkDB All DBs Position 2:1199784..1200041 Genome browser AA seq 85 aa AA seqDB search MTDTVSTDDILGKLTEIFREIFDDDDLVLTMDSTADDIDKWDSLNHISIIIACEMRFKVK FQTAEIEGLKDVGELVDLIRSKQSQ NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgacggacaccgttagcaccgacgacatcctcggcaaattgaccgagatattccgcgag atcttcgacgacgacgatctggtcctgacaatggacagtaccgccgacgacatcgacaaa tgggattcgttgaatcacatcagcatcatcatcgcgtgcgaaatgcgttttaaggtgaag tttcagacggctgaaatcgaaggtctgaaagatgtcggcgaactggtcgatctgatccgc agcaagcagtcgcaataa

DBGET integrated database retrieval system