Paraburkholderia ginsengisoli: I6I06_24465 Help Entry I6I06_24465       CDS       T07246                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pgis  Paraburkholderia ginsengisoli Brite KEGG Orthology (KO) [BR:pgis00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pgis03032]     I6I06_24465    03036 Chromosome and associated proteins [BR:pgis03036]     I6I06_24465    03400 DNA repair and recombination proteins [BR:pgis03400]     I6I06_24465 DNA replication proteins [BR:pgis03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     I6I06_24465 Chromosome and associated proteins [BR:pgis03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     I6I06_24465 DNA repair and recombination proteins [BR:pgis03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       I6I06_24465 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  QQC65944 UniProt:  A0A7T4TAN2 LinkDB All DBs Position 2:complement(1753394..1753672) Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAAATGESKAATGQTIDAIVEAVTKAVVSGDTVQLVGFGSFSTGARAARVG RNPSTGAEIQIAAAKTVKFTAGKAFKEAVNAS NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgattgatgcagtcgccgcagcgacgggcgaaagcaaagcggcc accggccaaaccatcgacgcaatcgtcgaagcggtgaccaaagccgtggtgagcggcgat acggtgcaactggtcggtttcggttctttctcgactggcgcgcgcgcagcacgcgtcggc cgcaatccgtcgacgggtgccgagatccagatcgccgctgccaagacggtgaaattcacc gccggcaaggcattcaaggaagctgtcaacgcgtcgtaa

DBGET integrated database retrieval system