Paraburkholderia ginsengisoli: I6I06_25580
Help
Entry
I6I06_25580 CDS
T07246
Name
(GenBank) DUF802 domain-containing protein
Organism
pgis
Paraburkholderia ginsengisoli
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DUF802
Med13_C
Apolipoprotein
Motif
Other DBs
NCBI-ProteinID:
QQC66151
UniProt:
A0A7T4N6H2
LinkDB
All DBs
Position
2:complement(2001881..2004499)
Genome browser
AA seq
872 aa
AA seq
DB search
MSRYRIDLVVFLAGLAAACWIAASYVGSNPLALAVTLLIGACYVAGALELRRYSQATGTL
TRAVAGLSGPPPGLAAWLEPLHPSLRNAARLRIEGERVALPGPALTPYLVGLLVLLGMLG
TLLGMVATLRGTGIALESATDLQAIRASLAAPVKGLGFAFGTSIAGVATSAMLGLLSALY
RRERLEAAQMLDMKIATSLRVYSQSHQREESFRLLQRQAEVMPTLVDRLQTMMAALEQQS
VASHERQLASQDAFHGKTEAAYLRLAGAVERSLKDSVADSARAAGAALQPVMEATLAGLA
RESAALHETVSQAVQRQLDGLSSGFAATSANVADIWNNALAKQQRSSDELTAQLRTSVER
AAETFEQRSAALLADVSARLDETAGGVSQAWQAALARQESVGEKLAANNQQALAMAAASF
EQHAASLVRTVGQSHTELQTELVSRDEERLAVWSGTFGAMASKLSEQWEQSGAQTASRQQ
QICETLAQTARDISAQTQAHASETIGEIERLVQAAAEAPKAAANLQAELAERDQQRLAAW
TETLGAMAAKLSEQWEQSGAQTASRQQQICETLAQTARDISAQTQAHASETIGEIERLVQ
AAAEAPKAAANLQAELAERDQQRLAAWTETLGAMAAKLSEQWEQSGAQTASRQQEICETL
AQTARDISAQTQAHASDTIGEIERLVQAASEAPKAAAEVVAELRQKLSDSMVRDTAMLQE
RSRLLETLETLLDAVNHASTEQRTAVDALVATSANLLERVGTRFTDHIEHETGKLGAVAA
QVTGSAVEVASLGEAFGAAVQIFGDSNDKLAAHLQRIETALDKSLARSDEQLAYYVAQAR
EVIDLSVMSQKQIVEDLQRIAGQRASAGADVV
NT seq
2619 nt
NT seq
+upstream
nt +downstream
nt
atgtccagatatcgtattgatctcgttgtgtttctggccggtctggccgctgcctgctgg
atcgccgccagctatgtcggttcgaacccgctggcgctggccgtcacgttattgatcggc
gcatgctacgtggcgggcgcgctcgaactgcgccgctacagccaggcgacgggcacgctg
acgcgcgcggtcgcgggcttatccgggccgccgccggggctcgccgcgtggcttgagccg
ctgcatccgagtctgcgcaacgcggcgcgcttgcgcatcgagggcgagcgcgtcgcgttg
ccgggtccggcattgacgccgtatctcgtcgggctgctggtgttgctcggcatgctgggc
acgctgctcggcatggtggcgacgttgcgcggcaccggcatcgcgctggagagcgcgacg
gacttgcaggcgatccgcgcttcgctggcggcgccggtcaaggggctggggtttgcgttc
ggcacgtcgattgcgggcgtggccacctcggcgatgctcgggctgttgtccgcgctgtat
cgccgcgagcggctcgaagcagcgcagatgctcgacatgaaaatcgcgacgagcctgcgc
gtgtattcgcagagccatcaacgcgaggaaagcttccgactgctgcagcgccaggcggag
gtgatgccgacgctggtcgatcgcttgcaaacgatgatggcggcgctcgaacagcagagc
gtcgcgtcgcacgagcggcaactcgcgagccaggacgcgttccatggcaagaccgaggcc
gcttatctgcgtctggccggcgctgtcgaacggtcgttgaaggacagcgtcgccgacagc
gcgcgcgctgcgggcgccgcgttgcagcctgtcatggaagcgacgctggccggtctcgcg
cgcgagtcggcggcgttgcacgagacagtatcgcaggcggtgcagcggcaactcgacgga
ctgtcgagcggctttgcggcgaccagcgcgaacgtcgccgacatctggaacaacgcgttg
gccaagcagcagcgttcgagcgatgagctgaccgcgcaactgcgcacgtcggtcgagcgc
gccgccgaaacgttcgagcaacgctcggcggcgttgctcgccgatgtgtccgcgcgtctg
gacgaaacggcgggcggggtgtcgcaagcatggcaggcggcgctggcgcggcaggagagc
gtcggcgaaaagctcgcggcgaacaatcagcaagcgctggcgatggccgcggcgagcttc
gagcagcatgcggcgtcgctggtgcggacggtcgggcagtcgcatacggagttgcaaacg
gaactggtttcgcgcgacgaagagcggctggcggtttggagcgggacgttcggggcgatg
gcgagcaagttgagcgagcagtgggagcagtcgggtgcacaaactgcgagccgtcagcag
caaatctgcgagacgcttgcgcaaaccgcccgcgacatctccgcacaaacgcaagcgcat
gcaagcgagacgatcggcgagatcgaacgcctcgtgcaagcggctgcggaagcaccgaag
gcagcggcgaacctgcaggcggaattggccgagcgggatcaacagcgactggcggcatgg
accgaaacgctcggtgccatggccgcgaagttgagcgagcagtgggagcagtcgggcgca
caaaccgcgagccgtcagcagcaaatctgcgagacgcttgcgcaaaccgcccgcgacatc
tccgcacaaacgcaagcgcatgcaagcgagacgatcggcgagatcgaacgcctcgtgcaa
gcggctgcggaagcaccgaaggcagcggcgaacctgcaggcggaattggccgagcgggat
caacaacgactggcggcatggaccgaaacgctcggcgccatggccgcgaagttgagcgag
cagtgggagcagtcgggcgcacaaaccgcgagccgtcagcaggaaatctgcgagacgctt
gcgcagaccgcccgcgatatctccgcacaaacgcaagcgcatgcaagcgacacgatcggc
gagatcgaacgcctcgtgcaagccgcatcggaagcgccgaaggccgcagcggaagtggtc
gccgaattgcgccagaagctctccgacagcatggtgcgcgacaccgcgatgctgcaggag
cgcagccgtctgctcgaaacgctggagacgctgctcgacgcggtgaaccacgcgtccacc
gagcagcgcacggccgtcgacgcgctggtcgccacgtcggcgaatctgcttgagcgcgtc
ggcacgcgcttcaccgatcacatcgagcacgagaccggcaagctcggcgcggtggccgcg
caggtcacgggcagcgcggtcgaagtggcgagcctcggcgaggcgttcggcgcggccgtg
cagatattcggcgattcgaacgacaagctggcggcgcacctgcaacgtatcgaaaccgcg
ctcgacaagtccctcgcccgcagcgacgaacaactggcctactacgtcgcgcaggcgcgt
gaagtgatcgacctgagcgtgatgtcgcaaaagcagatcgtcgaagacctgcaacggatc
gcgggccagcgcgcctcagccggagccgatgtcgtatga
DBGET
integrated database retrieval system