Phaeobacter inhibens 2.10: PGA2_c15830 Help Entry PGA2_c15830       CDS       T02193                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism pgl  Phaeobacter inhibens 2.10 Pathway pgl01100   Metabolic pathways pgl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pgl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PGA2_c15830    00074 Mycolic acid biosynthesis     PGA2_c15830   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PGA2_c15830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  AFO87585 LinkDB All DBs Position complement(1745640..1745894) Genome browser AA seq 84 aa AA seqDB search MSTQDKVIAIIAEQAVLEPSDVTLDSTLEDLGIDSLGLVESIFAIEEEFDITIPFNANEP EKSDFDISNVAAIIAGIDKLISEK NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagcacacaggacaaggtcatcgccatcattgccgaacaggctgtgctggagccatcg gatgtgacactcgacagtacgctggaggatctggggatcgacagcctcggcctcgtcgag agtatcttcgccattgaggaagagtttgatatcaccattcctttcaatgccaatgaaccg gaaaaaagcgattttgacatctccaacgtagcggcaattattgcgggcatcgacaagctg atttcagaaaaatga

DBGET integrated database retrieval system