Phaeobacter inhibens 2.10: PGA2_c17620 Help Entry PGA2_c17620       CDS       T02193                                  Symbol acpP Name (GenBank) acyl carrier protein AcpP   KO K02078   acyl carrier protein Organism pgl  Phaeobacter inhibens 2.10 Pathway pgl01100   Metabolic pathways pgl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pgl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PGA2_c17620 (acpP)    00074 Mycolic acid biosynthesis     PGA2_c17620 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PGA2_c17620 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AFO87759 LinkDB All DBs Position complement(1951335..1951568) Genome browser AA seq 77 aa AA seqDB search MSDVADRVKKIVVEHLGVEEDKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFISEAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgtcgcagaccgcgtaaaaaagatcgttgtggaacacctgggtgttgaagaa gacaaagtgaccgagaacgcgtcgttcatcgatgatctgggcgcagacagcctggacacc gttgagctggttatggccttcgaagaagagttcggcatcgaaatccccgatgacgcagcc gagaccatccagacctttggcgatgcggtgaagttcatcagcgaagcttcctga

DBGET integrated database retrieval system