Phaeobacter inhibens 2.10: PGA2_c34090 Help Entry PGA2_c34090       CDS       T02193                                  Name (GenBank) putative rod-binding protein   KO K02395   peptidoglycan hydrolase FlgJ Organism pgl  Phaeobacter inhibens 2.10 Pathway pgl02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pgl00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     PGA2_c34090  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pgl02035]     PGA2_c34090 Bacterial motility proteins [BR:pgl02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     PGA2_c34090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  AFO89369 LinkDB All DBs Position complement(3693932..3694222) Genome browser AA seq 96 aa AA seqDB search MEPIAQLPAMRRPAAITPPPQDPLRKAAQELEATFLTEMLKSAGLGESRETMGGGAGEDQ FSSFLVRAQAEQITKAGGVGLAESLYHALKEAQDND NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggaaccaattgctcaacttccggcgatgcggcgccccgctgccatcaccccgccgcca caagatccgctgcgcaaggccgcacaggagcttgaggcgaccttccttacagaaatgttg aaatccgccggtcttggcgaaagtcgcgaaacaatgggcggcggcgcgggcgaagatcag ttttccagtttcctggtgcgcgcgcaggcggagcaaatcaccaaagcgggcggcgtcggc ctggcagaatcactttatcacgcattgaaagaggcacaggacaatgactga

DBGET integrated database retrieval system