Paenibacillus graminis: PGRAT_11450 Help Entry PGRAT_11450       CDS       T03325                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism pgm  Paenibacillus graminis Pathway pgm00998   Biosynthesis of various antibiotics pgm01100   Metabolic pathways pgm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pgm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PGRAT_11450    00074 Mycolic acid biosynthesis     PGRAT_11450   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PGRAT_11450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Piezo_THU9_anchor Motif Other DBs NCBI-ProteinID:  AIQ68160 UniProt:  A0A089M707 LinkDB All DBs Position 2696150..2696359 Genome browser AA seq 69 aa AA seqDB search MDLPDSAAPDTDLMNSLGFDSIQLIQLIVNLETALDFEFEDQDMSMEHFLKLEDLVHLVE QRITEQTTL NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggatttacccgattcagcggctcctgatacggatctgatgaacagtctaggattcgat tccattcagttaatccagctgatagtgaacttagagacagcgctggattttgaatttgaa gaccaggatatgtcgatggaacactttttgaaattggaagatttagttcatttggtagag caacggatcacagaacaaaccacattataa

DBGET integrated database retrieval system