KEGG   Porphyromonas gingivalis ATCC 33277: PGN_1734
Entry
PGN_1734          CDS       T00714                                 
Name
(GenBank) nucleoside permease NupG
  KO
K11537  MFS transporter, NHS family, xanthosine permease
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Brite
KEGG Orthology (KO) [BR:pgn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pgn02000]
    PGN_1734
Transporters [BR:pgn02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Nucleoside:H+ symporter (NHS) family [TC:2.A.1.10]
    PGN_1734
SSDB
Motif
Pfam: Nuc_H_symport MFS_1_like MFS_1 LacY_symp
Other DBs
NCBI-ProteinID: BAG34253
UniProt: B2RLK8
LinkDB
Position
complement(1945016..1946239)
AA seq 407 aa
MKYRLTLMNFLQFFIWGAWLISLGGYMASVLHYSGLEIGAIYGTMGIASLFMPGLLGILA
DKYVAAQKLLGACHLIGAILLVYASTLSSYSVFYPVMLLLCMSYMPTLALTNTIAYTAME
KAGMDIVREFPPIRVWGTVGFILAMWTVDICGWVMSSMQFYVSAVASLALGLYAFTLPHC
PPAKENKKKGVLAVLGLDAFVLFRQRRMAIFFLFAMLLGAALQVTNTFGNPFLSHFADAY
SESFAVQHPNVLLSLSQISETLFILTIPFFMGRFGIKRVMLMSMLAWVLRFAFFGLGNPG
SGFIFLVLSMIVYGMAFDFFNISGSMFVDRETTPSIRAAAQGLFMIMTNGIGAIIGGFAS
GWVVDRFTDAGHTAWSTVWYIFAAYALVIAILFAFFFKSESSPLSRS
NT seq 1224 nt   +upstreamnt  +downstreamnt
ttgaaatatcgtctgaccctgatgaacttcctgcagtttttcatttggggagcttggctg
atttcccttggtggatatatggcgagcgtactgcattattccggtttggaaataggtgcc
atatacggtacgatgggcattgcctctcttttcatgccgggtttgctgggtattctggcg
gacaagtacgtggcagcacaaaagctcttgggggcgtgccatctgatcggagccatattg
ctggtttatgcttccacgctgagtagttactccgttttttatcccgttatgctcctgctc
tgcatgagctatatgcctaccctcgctctcaccaatacgatagcctatactgctatggag
aaagccggtatggatatagtgcgcgaatttcctcctatacgcgtatggggtactgtcggc
ttcattttggccatgtggaccgtcgatatatgcggatgggtaatgagcagtatgcaattc
tatgtcagtgcggtggcttcccttgcattgggattgtatgcttttaccttgcctcactgc
cctccggcaaaagaaaacaagaagaagggggtgcttgccgtcttggggctggatgctttt
gtccttttccgccaacgtcgtatggctatcttcttcctctttgccatgctattgggagca
gcccttcaggtcaccaatacattcggcaatccgtttttgtctcattttgcggatgcttat
agcgagagctttgccgtgcagcaccccaatgtgttgctttctttgtcgcagatttccgag
actcttttcattttgaccattccgtttttcatggggcgtttcgggatcaaacgggtgatg
cttatgagtatgttggcttgggtgttgcgttttgctttctttggtcttggcaatccgggt
agcggcttcattttcctcgttctgtcgatgatcgtatatggtatggccttcgatttcttc
aatatcagcggttccatgtttgtcgatcgagagactacaccatcgattcgggcagctgct
caaggcctttttatgataatgaccaatggtatcggagctatcatcggcggatttgccagc
ggttgggtggtagatcgctttacggatgccggtcatacggcttggagcacggtatggtat
attttcgcagcttatgcattggtcattgccatcctctttgctttctttttcaagtcggaa
agcagtcccctctctcgatcttag

DBGET integrated database retrieval system