KEGG   Paraburkholderia graminis: CUJ91_01835
Entry
CUJ91_01835       CDS       T05548                                 
Name
(GenBank) signal recognition particle-docking protein FtsY
  KO
K03110  fused signal recognition particle receptor
Organism
pgp  Paraburkholderia graminis
Pathway
pgp02024  Quorum sensing
pgp03060  Protein export
pgp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pgp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    CUJ91_01835
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CUJ91_01835
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CUJ91_01835
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pgp02044]
    CUJ91_01835
Secretion system [BR:pgp02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   CUJ91_01835
SSDB
Motif
Pfam: SRP54 SRP54_N Zeta_toxin AAA_17 AAA_16 AAA_30 ABC_tran AAA_22 AAA_18 APS_kinase AAA_19 Thymidylate_kin CbiA SLFN-g3_helicase AAA_24 Viral_helicase1 YqeC AAA_14 AAA_33 AAA_27 ATP_bind_1 Rad17 SOG2
Other DBs
NCBI-ProteinID: AXF06776
LinkDB
Position
PHS1_A:complement(409084..410253)
AA seq 389 aa
MFSFFKRFKGSKESENAPDESQTAPDDLLDEPPAVEAPAAPRADAPGSIATPPAAAEPQF
VPQAQPETDVEEASLETVEIVPPPVPDESAKRSWLTRLKTGLSKTSSSITGIFVGAKIDE
DLYEELETALLMSDAGVDATEFLLEALREKVRAERLTEPQQVKAALRTLLVDLLRPLEKS
LMLGRAKPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGQ
RNNVTVVAQESGDPAAVIFDAVGAARARKIDVMMADTAGRLPTQLHLMEELRKVKRVIGK
AQDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPI
PVYFIGVGEKVEDLQPFSAEEFSDALLGG
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgttcagctttttcaaacgattcaagggttcgaaagagtccgaaaacgcgccagacgaa
tcgcagaccgcgcctgacgatcttctcgacgagccgcctgcggtagaagcaccggccgcg
ccgcgtgccgatgcgcccggcagcatcgcgacaccgcctgcagccgctgagccccaattt
gtgccgcaagcccagccagaaaccgacgtcgaagaagcgtcgttagaaacggtagagatc
gtgccgccgccggttccggacgagagcgcgaaacgctcatggctgactcgcctgaagacc
ggcttgtcgaaaacgagttcgagcatcaccggcattttcgtcggcgcaaagatcgacgaa
gatctttacgaagagctcgaaaccgcgctgctgatgtcggacgcaggcgtcgacgccacc
gaattcctgctcgaagcgctgcgcgagaaagtgcgcgccgagcgtctcacggagccgcag
caggtcaaggccgccctgcgcacgctgctcgtcgaccttctgaggccgctcgaaaaatcg
ctgatgctcgggcgcgccaagccgctcgtcatgatgatcgccggcgtcaacggcgcgggc
aaaacgaccagcatcggcaagctcgccaagcatctgcagagcttcgaccagtcggtgctg
ctggccgccggcgacacgttccgcgcggccgcgcgcgagcagttggccatctggggccag
cgcaacaacgtgaccgtagtcgcgcaggaaagcggcgacccggccgccgtgattttcgac
gcggtcggcgccgcgcgggcgcgcaagatcgacgtgatgatggccgacacggccggccgt
ctgccgacccaactgcatctgatggaagagctgcgcaaggtcaagcgcgtgattggcaag
gcgcaggacggcgcgccgcacgaggtgctgctcgtgatcgatgccaataccgggcagaac
gcgctcgcacaggtcaaggctttcgacgacgcgctcggcctcaccggcctcatcgtcacc
aagctcgacggcacggcgaagggcggcattctcgcggcaatcgcgcggcaaaggccaatt
ccggtttacttcatcggcgtcggcgagaaggtcgaggatttgcagcccttcagcgccgag
gagttttcggacgcgttgctcggcggctga

DBGET integrated database retrieval system