Paraburkholderia graminis: CUJ91_12995 Help Entry CUJ91_12995       CDS       T05548                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pgp  Paraburkholderia graminis Pathway pgp00998   Biosynthesis of various antibiotics pgp01100   Metabolic pathways pgp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pgp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CUJ91_12995    00074 Mycolic acid biosynthesis     CUJ91_12995   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CUJ91_12995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AXF08726 LinkDB All DBs Position PHS1_A:complement(2940114..2940353) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaatatcgaacagcgcgtcaagaagatcgtcgcagaacaactgggcgtggccgaa gctgaaatcaagaacgaagcttcgttcgtgaacgacctcggcgccgactcgctggacacg gttgaactcgtgatggccctcgaagacgaattcggcatggaaattccggatgaggaagcc gagaagatcaccaccgttcagcaagcgatcgactacgctcgcgcaaacgtcaaggcctaa

DBGET integrated database retrieval system