Paraburkholderia graminis: CUJ91_13705 Help Entry CUJ91_13705       CDS       T05548                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pgp  Paraburkholderia graminis Pathway pgp00998   Biosynthesis of various antibiotics pgp01100   Metabolic pathways pgp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pgp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CUJ91_13705    00074 Mycolic acid biosynthesis     CUJ91_13705   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CUJ91_13705 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TerB Motif Other DBs NCBI-ProteinID:  AXF08849 LinkDB All DBs Position PHS1_A:complement(3095379..3095636) Genome browser AA seq 85 aa AA seqDB search MTVSEAEILERIRAIFKENFAIEPERVTPDAHLFEDLDLDSIDAVDLAIKLQEMTGRRIK PEEFKSVRTVGDVIGAVESLLAAQG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaccgtgtccgaggcagagattcttgaacgcatccgcgccatctttaaagagaacttc gcaatcgagcccgagcgcgtgacgcccgacgcgcatctgttcgaagacctcgatctggac agcatcgacgcggtcgatctcgctatcaagctccaggagatgaccgggcgccgcatcaag ccggaagagttcaaatcggtgcgcacggtcggcgacgtgatcggcgcggtcgaatcgctg ctggcggctcaaggctga

DBGET integrated database retrieval system