Puccinia graminis: PGTG_17023
Help
Entry
PGTG_17023 CDS
T02226
Name
(RefSeq) E3 ubiquitin ligase complex SCF subunit sconC
KO
K03094
S-phase kinase-associated protein 1
Organism
pgr
Puccinia graminis
Pathway
pgr03083
Polycomb repressive complex
pgr04111
Cell cycle - yeast
pgr04120
Ubiquitin mediated proteolysis
pgr04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
pgr00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
PGTG_17023
04120 Ubiquitin mediated proteolysis
PGTG_17023
09126 Chromosome
03083 Polycomb repressive complex
PGTG_17023
09140 Cellular Processes
09143 Cell growth and death
04111 Cell cycle - yeast
PGTG_17023
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
pgr04131
]
PGTG_17023
04121 Ubiquitin system [BR:
pgr04121
]
PGTG_17023
03036 Chromosome and associated proteins [BR:
pgr03036
]
PGTG_17023
Membrane trafficking [BR:
pgr04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
PGTG_17023
Ubiquitin system [BR:
pgr04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
PGTG_17023
Cul7 complex
PGTG_17023
Chromosome and associated proteins [BR:
pgr03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
PGTG_17023
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
PGTG_17023
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
BTB
Motif
Other DBs
NCBI-GeneID:
10529282
NCBI-ProteinID:
XP_003335788
UniProt:
E3L494
LinkDB
All DBs
AA seq
158 aa
AA seq
DB search
MVLMVTSDGEEFIVEKEVATRSALIKNMIEDLGESDNPIPLPNVSASVLKKVLEWCEHHK
KDPEPSAEDPDDARKRATEISDWDTKFINVDQEMLFEIILAANYLDIKPLLDVGCKSVAN
MIKGKQPEEIRKLFNIANDFTPEEEAQIKKENEWAEDR
NT seq
477 nt
NT seq
+upstream
nt +downstream
nt
atggtccttatggtaacatctgatggcgaggagttcattgttgaaaaggaagttgcgacc
cgcagtgccctgattaagaacatgatcgaagatcttggtgaatcggacaacccgatcccc
ttgcccaatgtttcagccagcgttctgaaaaaagtccttgaatggtgcgagcatcacaag
aaggatcccgagccctccgccgaggatcctgatgacgctcggaaacgagccaccgagata
agcgactgggataccaagttcatcaatgttgaccaggagatgctattcgagatcatattg
gctgccaactacttggacatcaagcctttactggacgtcggatgcaaatcggttgccaat
atgattaagggcaagcaacccgaagagattcggaagctcttcaacattgcaaacgacttc
accccagaggaggaagcccagatcaagaaggagaacgaatgggcagaggaccgataa
DBGET
integrated database retrieval system