Puccinia graminis: PGTG_21444 Help Entry PGTG_21444        CDS       T02226                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism pgr  Puccinia graminis Brite KEGG Orthology (KO) [BR:pgr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:pgr03041]     PGTG_21444   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pgr04052]     PGTG_21444 Spliceosome [BR:pgr03041]  Complex B   Other components    Complex B specific factors     PGTG_21444 Cytokines and neuropeptides [BR:pgr04052]  Neuropeptides   Unclassified    PGTG_21444 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Crinkler OTU1_UBXL Ubiquitin_4 UN_NPL4 DUF2103 Motif Other DBs NCBI-GeneID:  13540615 NCBI-ProteinID:  XP_003889890 UniProt:  H6QRF7 LinkDB All DBs AA seq 77 aa AA seqDB search MATTTGMIEVIANDRLGTKVRVKCSKEDTVGDLKKLIAAQTGTRFEKIRLKRANREFKNH ITLYDYEINDGTCLDLY NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggccactaccacagggatgatcgaggtgattgctaacgatcgactcggcactaaagtg agggtaaaatgcagtaaggaagatacagtcggagatctcaagaaattgatcgccgctcaa acgggcactcggttcgaaaaaattcgactcaagagggctaacagggagttcaagaatcat atcactttatacgattatgagattaatgatgggacgtgtcttgacctgtactag

DBGET integrated database retrieval system