Pyricularia grisea: PgNI_04342 Help Entry PgNI_04342        CDS       T09406                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism pgri  Pyricularia grisea Pathway pgri04145   Phagocytosis pgri04517   IgSF CAM signaling pgri04814   Motor proteins Brite KEGG Orthology (KO) [BR:pgri00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     PgNI_04342  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     PgNI_04342   09142 Cell motility    04814 Motor proteins     PgNI_04342  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pgri03037]     PgNI_04342    04812 Cytoskeleton proteins [BR:pgri04812]     PgNI_04342 Cilium and associated proteins [BR:pgri03037]  Motile cilia and associated proteins   Dynein arm    PgNI_04342 Cytoskeleton proteins [BR:pgri04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      PgNI_04342 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Cwc21_C Motif Other DBs NCBI-GeneID:  41959299 NCBI-ProteinID:  XP_030984961 UniProt:  A0A6P8BCX1 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MAEANPATREKLDAQIKAADMNDDLAMEIIDVAQEAMSRLTIEKDIAEHVKKTFDERKGP TWHCIVGRNFGSFVTHESKHFLYFYLGHCAFLVFKTQ NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggcagaagcgaaccccgccacacgggaaaagttggacgcccagatcaaggcggcggac atgaacgatgacctagcaatggagatcattgacgtcgcccaagaggcgatgtccaggctc actatcgaaaaggacattgcggagcatgtcaagaagacctttgacgagagaaagggtccc acatggcactgcatcgtcggtcggaactttggcagctttgtcacccacgagtccaaacac tttctttacttctaccttggccactgcgctttcctcgtctttaagacgcagtag

DBGET integrated database retrieval system