Pyricularia grisea: PgNI_05613 Help Entry PgNI_05613        CDS       T09406                                  Name (RefSeq) hypothetical protein   KO K03008   DNA-directed RNA polymerase II subunit RPB11 Organism pgri  Pyricularia grisea Pathway pgri03020   RNA polymerase pgri03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pgri00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     PgNI_05613   09124 Replication and repair    03420 Nucleotide excision repair     PgNI_05613  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pgri03021]     PgNI_05613    03400 DNA repair and recombination proteins [BR:pgri03400]     PgNI_05613 Transcription machinery [BR:pgri03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Core subunits      PgNI_05613 DNA repair and recombination proteins [BR:pgri03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       PgNI_05613 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_L_2 RNA_pol_L SF0329 Motif Other DBs NCBI-GeneID:  41960553 NCBI-ProteinID:  XP_030983214 UniProt:  A0A6P8B893 LinkDB All DBs Position I:complement(1951926..1952354) Genome browser AA seq 104 aa AA seqDB search MSNTSDFTFKKEDHTLGNMLCEHLKQHPNVLMAGYKVSHPNVPEFFLRIQTDGKVTPKAC LLDACRTILHSLGQIRTEFTREFELRRMVAAGEQQQNGEHGHGL NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgtcaaacacgtcagactttacattcaaaaaggaagaccatacgttgggcaacatgctc tgcgagcacctcaagcagcaccccaatgttctgatggcaggctacaaagtatctcaccct aacgtgcccgagttcttcctacgcatccagacggacggcaaggtgacgcccaaggcatgc ttactggacgcctgccgcacgatcctgcacagcctcggccagatccggaccgagttcacg cgagagtttgagctcaggcggatggttgctgccggggagcagcaacagaacggggagcat ggtcatggactctag

DBGET integrated database retrieval system