Pyricularia grisea: PgNI_08885 Help Entry PgNI_08885        CDS       T09406                                  Name (RefSeq) uncharacterized protein   KO K04393   cell division control protein 42 Organism pgri  Pyricularia grisea Pathway pgri04011   MAPK signaling pathway - yeast pgri04144   Endocytosis pgri04517   IgSF CAM signaling pgri04518   Integrin signaling pgri05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pgri00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     PgNI_08885   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     PgNI_08885    04518 Integrin signaling     PgNI_08885  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     PgNI_08885  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     PgNI_08885  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pgri04131]     PgNI_08885    03036 Chromosome and associated proteins [BR:pgri03036]     PgNI_08885   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pgri04147]     PgNI_08885    04031 GTP-binding proteins [BR:pgri04031]     PgNI_08885 Membrane trafficking [BR:pgri04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     PgNI_08885  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     PgNI_08885   Macropinocytosis    Ras GTPases     PgNI_08885 Chromosome and associated proteins [BR:pgri03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     PgNI_08885 Exosome [BR:pgri04147]  Exosomal proteins   Exosomal proteins of microglial cells    PgNI_08885   Exosomal proteins of breast milk    PgNI_08885 GTP-binding proteins [BR:pgri04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     PgNI_08885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  41963783 NCBI-ProteinID:  XP_030979407 UniProt:  Q9P8I4 LinkDB All DBs Position V Genome browser AA seq 194 aa AA seqDB search MVVATIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGDEPYTLGLFDT AGQEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVREKWFPEVHHHCPGVPCLIVGTQVD LRDDPSVREKLSKQKMQPVRREDGERMAKELGAVKYVECSALTQYKLKDVFDEAIVAALE PPTPKRKSKKCLIL NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atggtggttgcaacgattaaatgcgttgtcgtcggcgacggtgccgtcggtaaaacatgt ctccttatcagctacacaacaaacaagtttccgtccgaatacgtgccgaccgtgttcgac aactacgcagtgacggtaatgatcggggacgagccgtacacactgggacttttcgatacg gcaggacaagaagattacgacagactgcgacccctatcatacccacaaaccgacgttttt ctcgtatgcttcagcgtcacatcgccagcttcgtttgagaacgtaagggagaagtggttc cctgaggttcaccaccactgccccggcgtgccctgcctcattgtcggtacacaggttgat ctgagggatgaccccagcgtccgggagaagctgagcaagcagaagatgcaaccagtgcgg agggaggatggtgagcggatggctaaagaactcggtgccgttaagtacgtcgagtgcagt gctctaacgcagtacaagttgaaggatgtctttgatgaggcaatcgttgctgccctagag ccaccgacacccaagaggaaatccaaaaagtgcctgatcctttga

DBGET integrated database retrieval system