Pyricularia grisea: PgNI_08988 Help Entry PgNI_08988        CDS       T09406                                  Name (RefSeq) uncharacterized protein   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism pgri  Pyricularia grisea Pathway pgri03018   RNA degradation pgri03040   Spliceosome Brite KEGG Orthology (KO) [BR:pgri00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     PgNI_08988   09123 Folding, sorting and degradation    03018 RNA degradation     PgNI_08988  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pgri03019]     PgNI_08988    03041 Spliceosome [BR:pgri03041]     PgNI_08988 Messenger RNA biogenesis [BR:pgri03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      PgNI_08988   mRNA degradation factors    5'-3' decay     Lsm complex      PgNI_08988 Spliceosome [BR:pgri03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     PgNI_08988  Complex C   U2 snRNP components     PgNI_08988 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM Hfq AEP1 Muskelin_N Motif Other DBs NCBI-GeneID:  41963886 NCBI-ProteinID:  XP_030979163 UniProt:  A0A6P8AW63 LinkDB All DBs Position V Genome browser AA seq 97 aa AA seqDB search MLFFSFFKTLIDVEITVELKNSIQIRGTLKSVDQYLNLKLDDISVVEDIKYPHLSAVKNV FIRGSVVRYIHLPASHVDVPLLEDATRREAASTAPKR NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgttatttttcagcttcttcaagacgctgatcgacgtcgagatcaccgtcgagctcaag aacagcatccagatccgcggcaccctcaagagcgttgaccagtacctaaacctcaagctt gacgacatatccgtcgtcgaggatatcaagtatccgcacctgagcgccgtcaagaatgtc ttcatacgcggaagcgtagtcaggtacatccacctgcctgcttcccacgtcgacgtcccg cttttggaggacgcgacgaggagggaagcggcttctacggcgcccaagcgttaa

DBGET integrated database retrieval system