Porphyromonas gingivalis TDC60: PGTDC60_0078 Help Entry PGTDC60_0078      CDS       T01516                                  Name (GenBank) ferredoxin, 4Fe-4S   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pgt  Porphyromonas gingivalis TDC60 Pathway pgt00020   Citrate cycle (TCA cycle) pgt00720   Other carbon fixation pathways pgt01100   Metabolic pathways pgt01110   Biosynthesis of secondary metabolites pgt01120   Microbial metabolism in diverse environments pgt01200   Carbon metabolism pgt01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pgt00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     PGTDC60_0078   09102 Energy metabolism    00720 Other carbon fixation pathways     PGTDC60_0078 Enzymes [BR:pgt01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      PGTDC60_0078 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_2 Fer4_21 Fer4_10 Fer4_16 Fer4_9 LdpA_Fe-S-bd Fer4_15 Fer4_4 Fer4_3 Fer4_22 Fer4_17 Fer4_13 Fer4_8 Fer4_18 Motif Other DBs NCBI-ProteinID:  BAK24248 LinkDB All DBs Position 95323..95550 Genome browser AA seq 75 aa AA seqDB search MAKIRGAVVVNTQRCKGCNLCVVACPTKVLELHPNEVNDKGYHYSYMKDPESCIGCTSCA TVCPDACITVYKVKL NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaatcagaggagctgtggtcgttaatacccagcgttgcaaaggttgcaatcta tgtgtagtggcttgcccgacaaaagtgctggagctacacccgaatgaagtcaatgacaaa ggctatcattactcttatatgaaagatcccgaaagctgtatcggctgcaccagttgtgca acggtatgcccggacgcatgtatcacggtttacaaagtgaaattgtaa

DBGET integrated database retrieval system