Meyerozyma guilliermondii: PGUG_00445 Help Entry PGUG_00445        CDS       T01150                                  Name (RefSeq) hypothetical protein   KO K03017   DNA-directed RNA polymerase II subunit RPB9 Organism pgu  Meyerozyma guilliermondii Pathway pgu03020   RNA polymerase pgu03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pgu00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     PGUG_00445   09124 Replication and repair    03420 Nucleotide excision repair     PGUG_00445  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pgu03021]     PGUG_00445    03400 DNA repair and recombination proteins [BR:pgu03400]     PGUG_00445 Transcription machinery [BR:pgu03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol II specific subunits      PGUG_00445 DNA repair and recombination proteins [BR:pgu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       PGUG_00445 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Zn_ribbon_TFIIS Zn_ribbon_RPB9 Zn_ribbon_recom C1_1 Zn_ribbon_GRF DUF7351 RUBY_RBDX Motif Other DBs NCBI-GeneID:  5128581 NCBI-ProteinID:  XP_001487068 UniProt:  A5DAZ0 LinkDB All DBs AA seq 112 aa AA seqDB search MASFRFCAECNNMLYPREDKENSRLLYSCRNCDYTELAENPKVYRHELMTNIGETAGVVQ DIGNDPTLPRSDKECPRCSNKDCVFFQSQQRRKDTSMILFYVCLECKKVFRA NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggcgtcttttcgattctgcgccgagtgcaacaatatgttgtatccaagagaagataaa gagaattcacggctcttgtactcttgccgaaattgtgattatactgagttggctgagaat cccaaagtttatcgtcacgaattaatgacaaatattggagaaactgcgggtgttgttcaa gatataggaaacgatccaacgttgccaaggtcagataaagagtgtccgcgttgtagcaat aaggattgtgtgtttttccagtcacagcagcggcgtaaagacacaagtatgattttgttt tatgtgtgcttggagtgtaaaaaagtatttagagcttga

DBGET integrated database retrieval system