Meyerozyma guilliermondii: PGUG_01234 Help Entry PGUG_01234        CDS       T01150                                  Name (RefSeq) 60S ribosomal protein L40   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism pgu  Meyerozyma guilliermondii Pathway pgu03010   Ribosome pgu04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:pgu00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     PGUG_01234   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     PGUG_01234  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:pgu03011]     PGUG_01234    04121 Ubiquitin system [BR:pgu04121]     PGUG_01234 Ribosome [BR:pgu03011]  Ribosomal proteins   Eukaryotes    Large subunit     PGUG_01234   Archaea     PGUG_01234 Ubiquitin system [BR:pgu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    PGUG_01234 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L40e Motif Other DBs NCBI-GeneID:  5128403 NCBI-ProteinID:  XP_001485563 UniProt:  A5DD83 LinkDB All DBs AA seq 52 aa AA seqDB search MIEPSLKALASKYNCEKSICRKCYARLPPRATNCRKRKCGHTNQLRPKKKLK NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atgattgaaccatcgttgaaggctttggcttccaaatacaactgtgaaaagtcgatctgt cgtaaatgttacgctagattgccaccaagagccaccaactgtcgtaagagaaagtgtgga cacaccaaccaattgagacctaagaagaagttgaagtag

DBGET integrated database retrieval system