Meyerozyma guilliermondii: PGUG_01457
Help
Entry
PGUG_01457 CDS
T01150
Name
(RefSeq) hypothetical protein
KO
K17795
mitochondrial import inner membrane translocase subunit TIM17
Organism
pgu
Meyerozyma guilliermondii
Brite
KEGG Orthology (KO) [BR:
pgu00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
pgu03029
]
PGUG_01457
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
pgu02000
]
PGUG_01457
Mitochondrial biogenesis [BR:
pgu03029
]
Mitochondrial protein import machinery
Inner mambrane
TIM23 complex
PGUG_01457
Transporters [BR:
pgu02000
]
Other transporters
Primary active transporters [TC:
3
]
PGUG_01457
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Tim17
Motif
Other DBs
NCBI-GeneID:
5127608
NCBI-ProteinID:
XP_001485786
UniProt:
A5DDV6
LinkDB
All DBs
AA seq
153 aa
AA seq
DB search
MSADHARDPCPIVILNDFGGAFAMGVIGGCVWHGIKGFRNSPYGERMYGSMAAVKARAPV
VGGNFGVWGGLFSTFDCTVKAVRRREDAWNAVIAGFFTGGALALRGGWKHTRNSAITCAC
LLGVFEGVGMMMQRLSAQPTVAPVYPEEQPLSA
NT seq
462 nt
NT seq
+upstream
nt +downstream
nt
atgtcggcggatcatgctagggacccatgtccaatcgtcattcttaacgatttcggaggt
gcttttgctatgggagtgattggaggttgcgtatggcacggaatcaaaggtttcagaaac
tcgccatatggtgaaagaatgtacggttcgatggcggcagtcaaagcccgtgctccagtt
gtgggaggaaactttggagtttggggaggattattttctacattcgattgtactgtcaaa
gccgtaagaagaagagaagatgcatggaatgcagttattgctggatttttcaccggtgga
gctttggctttgagaggtggatggaaacatactagaaactcggccattacatgtgcctgt
ttgttgggtgtgtttgagggtgttggtatgatgatgcaaagactttcggcacaacctaca
gtggctccagtgtaccctgaggagcagccattgtcggcatga
DBGET
integrated database retrieval system