Meyerozyma guilliermondii: PGUG_04052 Help Entry PGUG_04052        CDS       T01150                                  Name (RefSeq) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism pgu  Meyerozyma guilliermondii Pathway pgu03020   RNA polymerase pgu03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pgu00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     PGUG_04052   09124 Replication and repair    03420 Nucleotide excision repair     PGUG_04052  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pgu03021]     PGUG_04052    03400 DNA repair and recombination proteins [BR:pgu03400]     PGUG_04052 Transcription machinery [BR:pgu03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      PGUG_04052   RNA polymerase III system    RNA polymerase III      PGUG_04052   RNA polymerase I system    RNA polymerase I      PGUG_04052 DNA repair and recombination proteins [BR:pgu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       PGUG_04052 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Motif Other DBs NCBI-GeneID:  5125204 NCBI-ProteinID:  XP_001483323 UniProt:  A5DLA1 LinkDB All DBs AA seq 72 aa AA seqDB search MIIPIRCFSCGKVVGDKWETYLEYLQDDTMTEGDALDKLKLRRYCCRRMVLTHVDLIEKF LRYNPLEKKEIV NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgatcattcccatccggtgcttttcctgcggcaaggtcgtgggagacaagtgggaaact tacctcgagtacttgcaggacgacacgatgactgagggtgacgctttggacaaattaaag ttgcgtcgttattgttgtagaagaatggttttgactcatgtcgatttgatcgaaaagttt ttacgctacaatccattggagaagaaggaaattgtataa

DBGET integrated database retrieval system