KEGG   Meyerozyma guilliermondii: PGUG_04652
Entry
PGUG_04652        CDS       T01150                                 
Name
(RefSeq) hypothetical protein
  KO
K06663  DNA damage checkpoint protein
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu04111  Cell cycle - yeast
pgu04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    PGUG_04652
   04113 Meiosis - yeast
    PGUG_04652
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pgu03400]
    PGUG_04652
DNA repair and recombination proteins [BR:pgu03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    PGUG_04652
SSDB
Motif
Pfam: Rad9 Gp37
Other DBs
NCBI-GeneID: 5124517
NCBI-ProteinID: XP_001482697
UniProt: A5DN01
LinkDB
AA seq 445 aa
MFVVVLKDGKSRRIWSRTVCALAAVSEGIKFVISQRQLSISAINGARTAHGEIVFDRDFF
HDFYVDFDHVLRDGYEAGDGMERQHEDGHHKEIATYSFLVNSKHLVTLFKTLDVNDLEYI
CLKVYWNEATVDAMKYKLLIEIKTKKLVVKKYQTSYQPVVRNRLLVAEEYKWQLLQNNDD
ITFLKIDQVIPRQFLDMIPTAVDDFKLEVRSHKVMFSGIKKAVVKDRDYLKQPMAVTVTL
GLRDLIDTNLREETDESRRKLIGFRLRDFKTFMSLISSLGSTSDENGPDYDLDEGLSIYL
KQPGDPIVFELCNITNVKIQFVQITNTASSEEGKEIKIPHHVVHEINKAPSTAPPAKRHK
KMLLMNPTIPSQETATQFMNSGRSSSPEPRIAYDLALRTRSTDQLFVEEHSQPHSRGSDS
SNDSHSDQPSQYGPTQQTTVKSIFD
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgtttgtagtggtgttaaaagatggcaaaagtcgacgaatttggagccggacagtctgt
gcgttggctgctgtgtctgaaggtatcaagtttgtaatcagtcagcgccagctttcgatt
tcggctataaacggcgccagaacagctcatggcgaaatcgtctttgatcgggattttttt
catgatttttatgtcgactttgaccatgtcttgagagacggttatgaagctggtgatgga
atggagcgtcagcatgaagatggacatcataaggagattgcaacgtactcttttttggtt
aattcgaagcatttggtgacgttgtttaagaccctcgatgtcaacgatttagagtatatt
tgcctcaaggtgtactggaatgaagccacagtggatgctatgaagtacaagctactcatt
gagatcaaaacgaagaaattggtggtgaaaaagtaccaaacctcgtaccagcccgtagta
cgaaatcggctactcgtggccgaagaatacaaatggcagcttctgcagaacaatgacgac
atcacatttttgaagatcgaccaggtgatacctaggcagtttctcgatatgataccgact
gctgtggatgattttaagcttgaagtgcgcagccacaaggtgatgttcagcggcatcaag
aaggcagttgtcaaggaccgtgattacctcaaacagccaatggcggtcacggtgactttg
gggcttcgtgacctcatcgacacgaacttacgggaggaaaccgacgagtcccgtagaaaa
ctgatagggtttcggcttcgtgactttaagacattcatgtccttgatatcttctttgggc
tccacctcggacgaaaatggacccgattatgacctggacgagggactttcgatatacttg
aagcagccaggagacccaatagtgtttgaactctgcaacataacaaacgtcaagatacag
ttcgtccagatcaccaataccgcatcctctgaagagggcaaagagattaaaattccgcac
catgtggtacatgaaatcaacaaggcaccaagtacggctcctccagcaaaacgtcacaag
aaaatgttattaatgaacccaactattccctcacaagaaaccgctactcagtttatgaac
tcgggtcgttcatcttcacccgagcctcgaattgcatacgacctggcgctccgaactcgt
tccacggaccaactcttcgttgaagaacacagccagcctcactctcgtggttcggactcg
agtaatgactcccatagcgaccagccgtcgcaatacggtcccacccagcaaaccaccgtc
aagtcaatatttgactga

DBGET integrated database retrieval system