Meyerozyma guilliermondii: PGUG_05425 Help Entry PGUG_05425        CDS       T01150                                  Name (RefSeq) hypothetical protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism pgu  Meyerozyma guilliermondii Pathway pgu03020   RNA polymerase pgu03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pgu00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     PGUG_05425   09124 Replication and repair    03420 Nucleotide excision repair     PGUG_05425  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pgu03021]     PGUG_05425    03400 DNA repair and recombination proteins [BR:pgu03400]     PGUG_05425 Transcription machinery [BR:pgu03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      PGUG_05425   RNA polymerase III system    RNA polymerase III      PGUG_05425   RNA polymerase I system    RNA polymerase I      PGUG_05425 DNA repair and recombination proteins [BR:pgu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       PGUG_05425 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  5124139 NCBI-ProteinID:  XP_001482405 UniProt:  A5DQ74 LinkDB All DBs AA seq 158 aa AA seqDB search MSDAEEAYNEGPENFDDFDQPDHFSDDEFQEPEGDNDAQAANGDVEMKAADGRTIVNGGL GPEDSLRRAKTAKELSIPKEKRTTTPYMTKYERARILGTRALQISLNAPVLVDIEGETDP LQIAMKELTQRKVPLVVRRYLPDGSYEDWGCDELIVDH NT seq 477 nt NT seq  +upstreamnt  +downstreamnt atgtcggacgccgaagaagcctacaacgagggtccagaaaacttcgacgactttgaccag cccgaccacttttcggacgatgagttccaggagccagaaggtgataatgatgcccaagca gccaacggtgatgtggagatgaaagccgccgatggaagaacaattgttaatggaggtttg ggacctgaagattcgttacgtcgagcaaaaaccgccaaggagctctcgatccccaaggaa aagcgtaccactacgccatacatgaccaagtatgaacgagctcgtattttgggaactcga gcattgcaaatttcactcaacgctcctgtattggttgatattgaaggagaaaccgaccca ttgcaaatagccatgaaggaattgacccagagaaaggttccgttggtggtgaggcggtac ttgccagacggatcgtatgaggactgggggtgtgatgagttgatagtggaccactag

DBGET integrated database retrieval system