Pantherophis guttatus (corn snake): 117656886 Help Entry 117656886         CDS       T07329                                  Name (RefSeq) ubiquitin   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism pgut  Pantherophis guttatus (corn snake) Pathway pgut03010   Ribosome pgut04120   Ubiquitin mediated proteolysis pgut04137   Mitophagy - animal pgut04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:pgut00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     117656886   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     117656886  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     117656886    04137 Mitophagy - animal     117656886  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:pgut03011]     117656886    04121 Ubiquitin system [BR:pgut04121]     117656886 Ribosome [BR:pgut03011]  Ribosomal proteins   Eukaryotes    Large subunit     117656886   Archaea     117656886 Ubiquitin system [BR:pgut04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    117656886 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ribosomal_L40e Ubiquitin_2 Rad60-SLD_2 DUF2604 TBK1_ULD Ubiquitin_5 OTU1_UBXL Dsc3_N Motif Other DBs NCBI-GeneID:  117656886 NCBI-ProteinID:  XP_034260956 UniProt:  A0A6P9AXU6 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKYVPWSVSGSRKMGVQALKTGL NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgcagatttttgtgaaaaccctcaccggcaaaaccatcacccttgaggtggagccaagt gacacaattgaaaatgtcaaggcaaaaattcaggacaaggaaggtattcctcctgatcag cagcgtctgatctttgcgggaaagcagctggaagatggacgcacactctcagactacaat atccagaaagagtccacccttcacttggtgctgcgtctccgtggaggaatcattgagcct tcactccgccagctggctcagaagtataactgcgacaagatgatctgccgcaagtatgtc ccatggagtgtgagcggttccaggaaaatgggggtgcaggctcttaagactggactgtag

DBGET integrated database retrieval system