Pantherophis guttatus (corn snake): 117661869 Help Entry 117661869         CDS       T07329                                  Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism pgut  Pantherophis guttatus (corn snake) Brite KEGG Orthology (KO) [BR:pgut00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:pgut01002]     117661869   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pgut04147]     117661869 Peptidases and inhibitors [BR:pgut01002]  Peptidase inhibitors   Family I25: cystatin family    117661869 Exosome [BR:pgut04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    117661869 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin SQAPI Motif Other DBs NCBI-GeneID:  117661869 NCBI-ProteinID:  XP_034266991 UniProt:  A0A6P9BFD5 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MSCGGLSEPKAATAETQQITREIKSQLEEKESRNFDTFDAVSYKTQVVAGINYFIKIHVG NDEYFHVRVYKRLPHENKPMELTNYQSKKEKHDDLTYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtcgtgcggcggactttccgagccaaaggcagcgactgcggagacgcagcaaatcacg cgggagataaagtcacagctggaagaaaaagaaagcaggaactttgataccttcgatgct gtttcatataaaacacaagtggttgccggaataaactatttcatcaagatccatgtgggg aatgatgagtactttcatgtgcgagtgtacaaaaggctcccccatgaaaacaagccaatg gagctcactaattaccagagcaagaaagaaaagcacgacgatttgacttatttctaa

DBGET integrated database retrieval system