Pantherophis guttatus (corn snake): 117662001 Help Entry 117662001         CDS       T07329                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism pgut  Pantherophis guttatus (corn snake) Pathway pgut04621   NOD-like receptor signaling pathway pgut05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pgut00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     117662001  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117662001  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pgut03110]     117662001 Chaperones and folding catalysts [BR:pgut03110]  Protein folding catalysts   Protein disulfide isomerase    117662001 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_9 DIM1 Glutaredoxin Thioredoxin_2 OST3_OST6 AhpC-TSA Redoxin Thioredoxin_7 Motif Other DBs NCBI-GeneID:  117662001 NCBI-ProteinID:  XP_034267156 UniProt:  A0A6P9BFW3 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MLPKMHNKKEFEEFLKSAGPRLVVVNFTAKWCGPCKIVRPFLHELAVRYENVLFCIVDVD LAEDVAVLCNIVVVPTFQFFMKGDKIFEVTGANKKKLEEKIEDFM NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgttgccaaaaatgcacaataagaaagaatttgaggaatttctgaagagcgcaggaccc cgccttgttgtggtgaactttacagcaaaatggtgtgggccttgcaaaattgttcgtcct tttcttcatgaattggctgttcgatatgaaaatgtcctattctgtatcgttgatgtagac ttggcagaagatgtagctgtcctctgcaatattgttgttgtgccaacatttcagttcttc atgaaaggagacaagatttttgaagtaactggggctaataaaaaaaaacttgaagagaag attgaagactttatgtaa

DBGET integrated database retrieval system