Pantherophis guttatus (corn snake): 117663788 Help Entry 117663788         CDS       T07329                                  Symbol NRAS Name (RefSeq) GTPase NRas isoform X1   KO K07828   GTPase NRas Organism pgut  Pantherophis guttatus (corn snake) Pathway pgut04010   MAPK signaling pathway pgut04012   ErbB signaling pathway pgut04068   FoxO signaling pathway pgut04137   Mitophagy - animal pgut04140   Autophagy - animal pgut04150   mTOR signaling pathway pgut04210   Apoptosis pgut04218   Cellular senescence pgut04370   VEGF signaling pathway pgut04371   Apelin signaling pathway pgut04540   Gap junction pgut04625   C-type lectin receptor signaling pathway pgut04810   Regulation of actin cytoskeleton pgut04910   Insulin signaling pathway pgut04912   GnRH signaling pathway pgut04916   Melanogenesis Brite KEGG Orthology (KO) [BR:pgut00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     117663788 (NRAS)    04012 ErbB signaling pathway     117663788 (NRAS)    04370 VEGF signaling pathway     117663788 (NRAS)    04371 Apelin signaling pathway     117663788 (NRAS)    04068 FoxO signaling pathway     117663788 (NRAS)    04150 mTOR signaling pathway     117663788 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     117663788 (NRAS)    04137 Mitophagy - animal     117663788 (NRAS)   09143 Cell growth and death    04210 Apoptosis     117663788 (NRAS)    04218 Cellular senescence     117663788 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     117663788 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     117663788 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     117663788 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     117663788 (NRAS)    04912 GnRH signaling pathway     117663788 (NRAS)    04916 Melanogenesis     117663788 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pgut04131]     117663788 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pgut04147]     117663788 (NRAS)    04031 GTP-binding proteins [BR:pgut04031]     117663788 (NRAS) Membrane trafficking [BR:pgut04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     117663788 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     117663788 (NRAS) Exosome [BR:pgut04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    117663788 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    117663788 (NRAS)   Exosomal proteins of breast cancer cells    117663788 (NRAS)   Exosomal proteins of colorectal cancer cells    117663788 (NRAS) GTP-binding proteins [BR:pgut04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     117663788 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha FeoB_N nSTAND3 Septin AAA_16 Ldh_1_N Motif Other DBs NCBI-GeneID:  117663788 NCBI-ProteinID:  XP_034270143 UniProt:  A0A6P9BH29 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MTSALCYVGRAFRRPRSLEVKALRKAMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDP TIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADIN LYREQIKRVKDSEDVPMVLVGNKCDLPTRTVDTKQAHEVAKSYGIPFIETSAKTRQGVED AFYTLVREIRQYRMKRLNSNEDGNQGCMGVSCLVM NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgacgtcagcgctgtgctacgtcggaagggcgttccggcgaccgcgaagcctggaagtg aaggctctgaggaaggcaatgactgagtacaaactggtggtagtaggagctgggggtgtt ggaaaaagtgccctgaccatccagcttatccagaatcacttcgtagatgaatatgatcct actattgaggattcttaccgcaaacaagttgttattgatggagagacttgtttgctagat atcctggatacggcaggacaggaggaatatagtgccatgagggaccaatatatgagaact ggggaaggctttctttgtgtgtttgccattaacaacagcaaatcatttgcagatataaat ctttacagagagcaaattaaaagagtgaaagattcagaagatgtaccaatggtattagtg ggaaacaaatgtgatttaccaacaagaacagtagacaccaagcaggctcacgaagtagca aagagctatggtattccattcattgagacatctgccaaaacaagacagggtgttgaagat gctttttatacattggttagagaaatccgtcagtatcgaatgaaaaggctcaacagtaat gaagatgggaatcaaggctgcatgggggtgtcatgtcttgtgatgtga

DBGET integrated database retrieval system