Pantherophis guttatus (corn snake): 117664470 Help Entry 117664470         CDS       T07329                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism pgut  Pantherophis guttatus (corn snake) Pathway pgut04010   MAPK signaling pathway pgut04137   Mitophagy - animal pgut04140   Autophagy - animal pgut04218   Cellular senescence pgut04371   Apelin signaling pathway pgut04625   C-type lectin receptor signaling pathway pgut04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:pgut00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     117664470 (RRAS)    04371 Apelin signaling pathway     117664470 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     117664470 (RRAS)    04137 Mitophagy - animal     117664470 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     117664470 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     117664470 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     117664470 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pgut04147]     117664470 (RRAS)    04031 GTP-binding proteins [BR:pgut04031]     117664470 (RRAS) Exosome [BR:pgut04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    117664470 (RRAS)   Exosomal proteins of bladder cancer cells    117664470 (RRAS) GTP-binding proteins [BR:pgut04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     117664470 (RRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 P-loop_TraG Motif Other DBs NCBI-GeneID:  117664470 NCBI-ProteinID:  XP_034271273 UniProt:  A0A6P9BKA9 LinkDB All DBs Position Unknown AA seq 202 aa AA seqDB search MNPSEGAAPLEKYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICNIDGIST RLDILDTAGQEEFGAMREQYMRTGEGFLLVYAVNDRGSFNEIHKFHTQILRVKDRDEFPM VLVGNKTDLDLYRQVTEEEALYFARENRIPYMEASAKVRFNVDESFYELVRAIRKFNELE SPPAPAFHPKKKDRKSCPCSIL NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atgaatcccagcgaaggtgcggcgccactggagaaatacaagctggtagtggtcggtgga ggcggcgtcggcaagagcgccctaactattcaattcatccagtcttactttgtttctgac tatgaccccacaattgaggactcctacacaaaaatctgcaatattgatggtatctcaacc cggctggacattctggacactgctggtcaagaagagtttggagctatgcgggaacaatac atgcgtacaggagaaggtttcctccttgtttatgctgtcaatgacaggggcagtttcaat gaaatccacaaattccacactcagatacttagagtgaaagaccgtgatgagttccctatg gtgcttgttggcaataagactgatctggatctttatcgacaggtaactgaagaggaggcc ctttattttgctcgggagaaccgaatcccctacatggaagcctctgcaaaggtccgattc aatgtggatgagtctttctatgagctggtccgtgctatcaggaagtttaatgaattggaa tctccccctgcccctgcctttcatcctaaaaagaaggatcgcaaaagctgtccttgttcc attctgtaa

DBGET integrated database retrieval system