Pantherophis guttatus (corn snake): 117665176 Help Entry 117665176         CDS       T07329                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism pgut  Pantherophis guttatus (corn snake) Pathway pgut04010   MAPK signaling pathway pgut04012   ErbB signaling pathway pgut04068   FoxO signaling pathway pgut04137   Mitophagy - animal pgut04140   Autophagy - animal pgut04144   Endocytosis pgut04150   mTOR signaling pathway pgut04210   Apoptosis pgut04218   Cellular senescence pgut04370   VEGF signaling pathway pgut04371   Apelin signaling pathway pgut04510   Focal adhesion pgut04540   Gap junction pgut04625   C-type lectin receptor signaling pathway pgut04810   Regulation of actin cytoskeleton pgut04910   Insulin signaling pathway pgut04912   GnRH signaling pathway pgut04916   Melanogenesis pgut05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pgut00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     117665176 (HRAS)    04012 ErbB signaling pathway     117665176 (HRAS)    04370 VEGF signaling pathway     117665176 (HRAS)    04371 Apelin signaling pathway     117665176 (HRAS)    04068 FoxO signaling pathway     117665176 (HRAS)    04150 mTOR signaling pathway     117665176 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     117665176 (HRAS)    04140 Autophagy - animal     117665176 (HRAS)    04137 Mitophagy - animal     117665176 (HRAS)   09143 Cell growth and death    04210 Apoptosis     117665176 (HRAS)    04218 Cellular senescence     117665176 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     117665176 (HRAS)    04540 Gap junction     117665176 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     117665176 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     117665176 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     117665176 (HRAS)    04912 GnRH signaling pathway     117665176 (HRAS)    04916 Melanogenesis     117665176 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117665176 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pgut04131]     117665176 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pgut04147]     117665176 (HRAS)    04031 GTP-binding proteins [BR:pgut04031]     117665176 (HRAS) Membrane trafficking [BR:pgut04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     117665176 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     117665176 (HRAS) Exosome [BR:pgut04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    117665176 (HRAS)   Exosomal proteins of colorectal cancer cells    117665176 (HRAS) GTP-binding proteins [BR:pgut04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     117665176 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N AAA_16 CbiA Motif Other DBs NCBI-GeneID:  117665176 NCBI-ProteinID:  XP_034272670 UniProt:  A0A6P9BYV4 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagagtataaactggtggtggttggagcaggaggcgttgggaaaagtgcattgact attcagctgattcagaatcattttgttgatgaatatgatcctaccatagaggattcgtac agaaagcaagtagtcatcgatggggagacctgcttactggacatcttggacactgctggc caagaggaatacagtgccatgcgagaccaatacatgaggacaggagaaggcttcctctgt gtcttcgctattaacaacaccaagtcctttgaagatattcatcaatatagagagcagatc aagagagtgaaggactccgatgatgtgcccatggtgttggtggggaataaatgtgacctt cctgcccggactgtggaaacacggcaagcccaggagctggctcggagctatgggattcca tacatagagacgtcagccaaaactagacagggagtcgaagatgccttctatactttagtg cgagagatccggcagcacaaattacgtaaattgaatcccccagatgaaagtggtccaggc tgcatgaactgcaagtgtgtaatatcatga

DBGET integrated database retrieval system