Pantherophis guttatus (corn snake): 117665291 Help Entry 117665291         CDS       T07329                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism pgut  Pantherophis guttatus (corn snake) Pathway pgut04010   MAPK signaling pathway pgut04137   Mitophagy - animal pgut04140   Autophagy - animal pgut04218   Cellular senescence pgut04371   Apelin signaling pathway pgut04625   C-type lectin receptor signaling pathway pgut04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:pgut00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     117665291 (RRAS2)    04371 Apelin signaling pathway     117665291 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     117665291 (RRAS2)    04137 Mitophagy - animal     117665291 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     117665291 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     117665291 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     117665291 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pgut04147]     117665291 (RRAS2)    04031 GTP-binding proteins [BR:pgut04031]     117665291 (RRAS2) Exosome [BR:pgut04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    117665291 (RRAS2)   Exosomal proteins of bladder cancer cells    117665291 (RRAS2) GTP-binding proteins [BR:pgut04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     117665291 (RRAS2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 RsgA_GTPase Motif Other DBs NCBI-GeneID:  117665291 NCBI-ProteinID:  XP_034272896 UniProt:  A0A6P9BZD2 LinkDB All DBs Position Unknown AA seq 203 aa AA seqDB search MAAGCRDGPGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERA ARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFP MILVGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRLNVDQAFHELVRVIRKFQEQ ECPPSPEPTRKEKDKKGCHCVIV NT seq 612 nt NT seq  +upstreamnt  +downstreamnt atggccgcgggctgcagggacggcccggggcaggaaaagtaccggctggtggtggtggga ggcggcggagtgggcaaatctgcgctcaccatccagttcatccagtcgtacttcgttaca gattatgatcccacaattgaagactcctacacaaaacaatgtgtaatagacgaaagagca gcaagattagatattctagatacagcaggccaagaagaatttggagctatgcgggaacag tatatgaggactggagaaggctttctgcttgtcttttcagtcacagatagaggaagtttt gaagaaatttataaatttcaaagacaaattcttagagtaaaagatcgtgatgagttccct atgattctagttggaaacaaagctgacctggaccatcagagacaggtaacacaggaggaa ggtcagcaattagcacggcagttgaaagtaacctatatggaagcttcagcaaaaatacgg ctcaatgtagatcaagcttttcatgaacttgtccgagttataaggaaatttcaagaacaa gaatgtcctccttccccagagccaacgaggaaggagaaggacaagaaagggtgccactgt gtcatcgtctaa

DBGET integrated database retrieval system