Pantherophis guttatus (corn snake): 117666589 Help Entry 117666589         CDS       T07329                                  Symbol UBL5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism pgut  Pantherophis guttatus (corn snake) Brite KEGG Orthology (KO) [BR:pgut00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:pgut03041]     117666589 (UBL5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pgut04052]     117666589 (UBL5) Spliceosome [BR:pgut03041]  Complex B   Other components    Complex B specific factors     117666589 (UBL5) Cytokines and neuropeptides [BR:pgut04052]  Neuropeptides   Unclassified    117666589 (UBL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Motif Other DBs NCBI-GeneID:  117666589 NCBI-ProteinID:  XP_060544990 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTDDCIRDLKKLIAAQTGTRWDKIVLKKWYTIFKDHVMLADY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaagtagtttgcaacgatcggctgggcaagaaagttagagtgaagtgcaacact gatgattgcatcagggatcttaagaagcttattgctgcccagactggtactcgctgggac aagattgttctgaagaagtggtatacaattttcaaggaccatgtgatgctggcagactat gaaatccatgatggcatgaacctggaattgtattatcaatag

DBGET integrated database retrieval system