Pantherophis guttatus (corn snake): 117670383 Help Entry 117670383         CDS       T07329                                  Name (RefSeq) metallothionein-2-like   KO K14739   metallothionein 1/2 Organism pgut  Pantherophis guttatus (corn snake) Brite KEGG Orthology (KO) [BR:pgut00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pgut03019]     117670383    03029 Mitochondrial biogenesis [BR:pgut03029]     117670383 Messenger RNA biogenesis [BR:pgut03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      117670383 Mitochondrial biogenesis [BR:pgut03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     117670383 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  117670383 NCBI-ProteinID:  XP_034281358 UniProt:  A0A6P9CAT6 LinkDB All DBs Position Unknown AA seq 63 aa AA seqDB search MDPQNCGCATGSSCSCNGSCKCKNCKCTSCKKSCCSCCPASCDNCAKGCVCKDPSLNKCS CCP NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggatcctcagaattgcggctgcgccaccggcagctcttgctcctgcaatggatcctgc aaatgcaaaaactgcaaatgtacttcgtgcaaaaaaagctgctgttcctgctgccccgcc agctgtgacaactgcgcgaaaggctgtgtctgcaaagacccttccctgaacaaatgcagc tgctgcccctga

DBGET integrated database retrieval system