Pantherophis guttatus (corn snake): 117672097 Help Entry 117672097         CDS       T07329                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism pgut  Pantherophis guttatus (corn snake) Pathway pgut04814   Motor proteins pgut05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pgut00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     117672097 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117672097 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pgut03037]     117672097 (DYNLT1)    04812 Cytoskeleton proteins [BR:pgut04812]     117672097 (DYNLT1) Cilium and associated proteins [BR:pgut03037]  Motile cilia and associated proteins   Dynein arm    117672097 (DYNLT1) Cytoskeleton proteins [BR:pgut04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      117672097 (DYNLT1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  117672097 NCBI-ProteinID:  XP_034284446 UniProt:  A0A6P9CXG1 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MDELQSAEETAFIVDEVSNIIKEAIEGTIGGNAYLHSKVNQWTTTVVEQILSQLTKLGKP FKYVVTCVIMQKNGAGLHTANSCFWDNAADGACTVRWENKTMYCIVSAFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggatgagctccagtctgccgaggagactgcatttattgtggatgaagtaagcaacatt ataaaagaggccatagaaggaacaataggtggcaatgcatatctgcatagcaaggtgaac caatggactacaactgttgtggagcagattttaagtcagttgacaaagctgggtaaacca ttcaaatatgttgtgacctgtgtgattatgcaaaaaaatggtgctggacttcacactgca aactcttgcttctgggacaatgccgctgatggagcttgcactgtaagatgggagaacaag actatgtactgtattgtcagtgcctttggacttgcaatataa

DBGET integrated database retrieval system