Pantherophis guttatus (corn snake): 117676055 Help Entry 117676055         CDS       T07329                                  Name (RefSeq) histone H2A.V   KO K11251   histone H2A Organism pgut  Pantherophis guttatus (corn snake) Pathway pgut03082   ATP-dependent chromatin remodeling pgut04217   Necroptosis Brite KEGG Orthology (KO) [BR:pgut00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     117676055  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     117676055  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pgut03036]     117676055   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pgut04147]     117676055 Chromosome and associated proteins [BR:pgut03036]  Eukaryotic type   Nucleosome assembly factors    Histones     117676055 Exosome [BR:pgut04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    117676055 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  117676055 NCBI-ProteinID:  XP_034291102 UniProt:  A0A6P9D616 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTA NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggaggcaaggctggcaaagacagtggaaaggccaaggcaaaggcagtatctcgc tcgcaaagagctgggcttcagttcccagtgggccgtatccacagacacttgaagactcgc accacaagccatggaagagttggcgctacagctgccgtgtacagtgctgcaattcttgaa tacctcactgctgaggtgttggagttggcaggcaacgcttcgaaggacctgaaggtaaaa cgcatcactccacgtcacttgcagcttgccattcgtggggatgaggagttggactccctt attaaagcaaccattgctggtggaggcgtaattcctcacatccacaagtctttgattgga aagaagggacagcagaagactgcgtaa

DBGET integrated database retrieval system