Pantherophis guttatus (corn snake): 117676661 Help Entry 117676661         CDS       T07329                                  Symbol POLE3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism pgut  Pantherophis guttatus (corn snake) Pathway pgut03030   DNA replication pgut03082   ATP-dependent chromatin remodeling pgut03410   Base excision repair pgut03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pgut00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     117676661 (POLE3)    03410 Base excision repair     117676661 (POLE3)    03420 Nucleotide excision repair     117676661 (POLE3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     117676661 (POLE3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pgut03032]     117676661 (POLE3)    03036 Chromosome and associated proteins [BR:pgut03036]     117676661 (POLE3)    03400 DNA repair and recombination proteins [BR:pgut03400]     117676661 (POLE3) Enzymes [BR:pgut01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      117676661 (POLE3) DNA replication proteins [BR:pgut03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     117676661 (POLE3) Chromosome and associated proteins [BR:pgut03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     117676661 (POLE3) DNA repair and recombination proteins [BR:pgut03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       117676661 (POLE3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone BUD22 CENP-T_C SAGA-Tad1 CIS_TMP DUF5427 DDHD RNA_pol_3_Rpc31 DUF4746 Raftlin Motif Other DBs NCBI-GeneID:  117676661 NCBI-ProteinID:  XP_034292211 UniProt:  A0A6P9DJ10 LinkDB All DBs Position Unknown AA seq 168 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNVSKEARSAISRAASVFVLYATSCANNFARKGK RKTLNAGDVISAMEEMEFQRFVGPLKESLEAYRNEQKGKKGVSELKKKDREKKEDAEDPD KNREEEENEEEGERMMEDEEEEEEAQQQNEEEEEVEEQQPNEEEEGES NT seq 507 nt NT seq  +upstreamnt  +downstreamnt atggctgagcggccggaggacctgaacctgcccaacgcggtcatcacgcggatcatcaag gaggcgctccccgacggagtgaacgtctcgaaggaagcgcggagtgccatctcccgggcg gccagcgtcttcgtcctctacgccacctcgtgtgccaataactttgcaaggaaggggaag agaaagacactgaatgccggagatgttatttctgctatggaagagatggaattccagcga ttcgttgggcccctaaaggaatccttggaagcttacaggaatgagcagaagggcaaaaag ggagtgtcagaactcaagaaaaaagacagagagaagaaggaagatgctgaggaccctgac aagaatcgggaagaagaagaaaatgaggaggagggagagaggatgatggaggacgaggag gaggaggaggaagcgcagcagcaaaatgaggaggaggaggaggtggaagagcagcagcca aatgaagaggaagaaggggagagctga

DBGET integrated database retrieval system