Pantherophis guttatus (corn snake): 117678291 Help Entry 117678291         CDS       T07329                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X2   KO K05759   profilin Organism pgut  Pantherophis guttatus (corn snake) Pathway pgut04810   Regulation of actin cytoskeleton pgut05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pgut00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     117678291 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117678291 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pgut04131]     117678291 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pgut04812]     117678291 (PFN2)    04147 Exosome [BR:pgut04147]     117678291 (PFN2) Membrane trafficking [BR:pgut04131]  Others   Actin-binding proteins    Others     117678291 (PFN2) Cytoskeleton proteins [BR:pgut04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      117678291 (PFN2) Exosome [BR:pgut04147]  Exosomal proteins   Proteins found in most exosomes    117678291 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  117678291 NCBI-ProteinID:  XP_034295147 UniProt:  A0A6P9DHE1 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGIFHSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcaggctggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgtgacgccaagtacgtctgggcagcgacggccgggggcatcttt cacagcattacgcctatagaaatagatatgattgtaggaaaagaccgcgaaggttttttt accaacggtctgactcttggtgcaaagaagtgttctgtgatccgagatagcctctatgtg gatggtgactgtacaatggacatcaggacaaagagccaaggtggcgaaccaacatataat gttgctgtaggcagagctggacgagtcttggtcttcgtaatgggcaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system