Pantherophis guttatus (corn snake): 117679240 Help Entry 117679240         CDS       T07329                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism pgut  Pantherophis guttatus (corn snake) Pathway pgut04081   Hormone signaling pgut04144   Endocytosis pgut04150   mTOR signaling pathway pgut04270   Vascular smooth muscle contraction pgut04310   Wnt signaling pathway pgut04350   TGF-beta signaling pathway pgut04510   Focal adhesion pgut04520   Adherens junction pgut04530   Tight junction pgut04621   NOD-like receptor signaling pathway pgut04625   C-type lectin receptor signaling pathway pgut04810   Regulation of actin cytoskeleton pgut05100   Bacterial invasion of epithelial cells pgut05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pgut00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     117679240 (RHOA)    04350 TGF-beta signaling pathway     117679240 (RHOA)    04150 mTOR signaling pathway     117679240 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     117679240 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     117679240 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     117679240 (RHOA)    04520 Adherens junction     117679240 (RHOA)    04530 Tight junction     117679240 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     117679240 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     117679240 (RHOA)    04625 C-type lectin receptor signaling pathway     117679240 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     117679240 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117679240 (RHOA)    05100 Bacterial invasion of epithelial cells     117679240 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pgut04131]     117679240 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pgut04147]     117679240 (RHOA)    04031 GTP-binding proteins [BR:pgut04031]     117679240 (RHOA) Membrane trafficking [BR:pgut04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     117679240 (RHOA) Exosome [BR:pgut04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    117679240 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    117679240 (RHOA)   Exosomal proteins of colorectal cancer cells    117679240 (RHOA)   Exosomal proteins of bladder cancer cells    117679240 (RHOA) GTP-binding proteins [BR:pgut04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     117679240 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  117679240 NCBI-ProteinID:  XP_034296894 UniProt:  A0A6P9DM08 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcggaaaaaactggttatagttggtgatggtgcctgtggcaagacatgt ctgctaattgtatttagtaaagaccagtttcctgaagtttatgttcctacagtatttgaa aactatgtagcagatattgaagttgatggaaagcaggtggagctggccttatgggataca gctggacaagaagattatgatcgacttaggccactttcatatccagacaccgatgttata ctaatgtgtttttcaattgatagtccagatagtttagaaaacattccagagaagtggact ccagaggtgaaacacttctgtcccaatgtacccatcattctggtaggaaataagaaggat ttgaggaatgatgaacacacaagacgggagttggctaaaatgaagcaggaaccagtcaaa cctgaagaaggtagagatatggcaaatcgcattggtgcttttggatacatggaatgcagt gcaaagaccaaagacggtgtgagggaagtttttgaaatggctactagagctgctttacaa gcccgacgtggcaagaaaaaatctgggtgccttctgttgtaa

DBGET integrated database retrieval system