Pantherophis guttatus (corn snake): 117679853 Help Entry 117679853         CDS       T07329                                  Symbol KRAS Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism pgut  Pantherophis guttatus (corn snake) Pathway pgut04010   MAPK signaling pathway pgut04012   ErbB signaling pathway pgut04068   FoxO signaling pathway pgut04137   Mitophagy - animal pgut04140   Autophagy - animal pgut04150   mTOR signaling pathway pgut04210   Apoptosis pgut04218   Cellular senescence pgut04370   VEGF signaling pathway pgut04371   Apelin signaling pathway pgut04540   Gap junction pgut04625   C-type lectin receptor signaling pathway pgut04810   Regulation of actin cytoskeleton pgut04910   Insulin signaling pathway pgut04912   GnRH signaling pathway pgut04914   Progesterone-mediated oocyte maturation pgut04916   Melanogenesis Brite KEGG Orthology (KO) [BR:pgut00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     117679853 (KRAS)    04012 ErbB signaling pathway     117679853 (KRAS)    04370 VEGF signaling pathway     117679853 (KRAS)    04371 Apelin signaling pathway     117679853 (KRAS)    04068 FoxO signaling pathway     117679853 (KRAS)    04150 mTOR signaling pathway     117679853 (KRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     117679853 (KRAS)    04137 Mitophagy - animal     117679853 (KRAS)   09143 Cell growth and death    04210 Apoptosis     117679853 (KRAS)    04218 Cellular senescence     117679853 (KRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     117679853 (KRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     117679853 (KRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     117679853 (KRAS)   09152 Endocrine system    04910 Insulin signaling pathway     117679853 (KRAS)    04912 GnRH signaling pathway     117679853 (KRAS)    04914 Progesterone-mediated oocyte maturation     117679853 (KRAS)    04916 Melanogenesis     117679853 (KRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pgut04131]     117679853 (KRAS)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:pgut04031]     117679853 (KRAS) Membrane trafficking [BR:pgut04131]  Endocytosis   Macropinocytosis    Ras GTPases     117679853 (KRAS) GTP-binding proteins [BR:pgut04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     117679853 (KRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Ribosomal_L25p AAA_16 Motif Other DBs NCBI-GeneID:  117679853 NCBI-ProteinID:  XP_060543511 UniProt:  A0A6P9E3Y5 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIQQHRLTKVCTEEKTPGC VKIKKCLLM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggaatacaagcttgtcgttgtcggggctggtggcgtaggcaagagcgccttgaca attcagctcatccagaaccattttgtagacgaatacgatcctacaatagaggattcttac aggaagcaagtggtcattgatggcgaaacctgcctcttggatattctggacacagctggc caagaagaatacagtgcaatgcgcgaccagtatatgagaacgggcgaggggtttttgtgt gtcttcgccataaacaacaccaaatcgtttgaagatatccatcattacagggagcaaatc aagcgagtaaaggattctgaagacgtgcccatggtgctagttggcaacaaatgtgatttg ccctccaggactgtagacaccaagcaggctcaggatttagcaagaagttacgggatccct ttcatcgaaacctccgcaaaaacacgacagagagtggaagatgctttctataccttggtg cgggagattcaacagcaccgattgacaaaagtctgcaccgaagaaaagacacctgggtgc gtgaaaattaaaaaatgccttttaatgtaa

DBGET integrated database retrieval system